P<ﾭfPQRSXYZ[\]^_TUVW`aJbc $ LP $` Hd`J  o!pB J  `oB I H8J0$@J H `"l0$@H8L0$@Jb  @"lH`o l(ao@oፙc #"! &ݭ ﾭHPﾭNa>`!6)61696<<1`K"BCZRR`2 J#h LYZb@02~2@`]BRd00< H IA !J KS L\> 1J cT0$@J `TJ `TJ@ ``gFo~0gdE10b`` 0 00g0b` B0AR0@BARJ ``0DJ 1`V0$@J !T0$@J !V0$@J `J LJ@  dbl"l"l"l"l"l"l"l"l"l"lJ !`0#@J @0#@` J `J @0J `0  ԨJ@`Ơ #APJ11R  IJ 0`` 0c"lo8`#J J `xJg 0I80 C oJ d 0AJ "@flN'P8R8go`fl`'J` @OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g1@|}~yz@F0ofl&l:9>=<0>'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g1@|}~yz@F0o?fl&l:9>=<0>'&l&524130#"! &lw&l`LgJFo 010 `h N0B0d`u807 p (0 d0 tP2'2 lP  L0RA0[00x!  A0[` OcPA A0\ A04\0jxl't pKLg)\J[ `0L@T\aJ ``T *` L a!^2clC0@h\0S0`!C0t@|\K0`dJ ``T J `)['ts0xK2L@+\`X@\``pOAT@qM\`aAT@\`O7` `@T 9f2lD0@]0T0`d`'lf2l٠D0@$]L0`D0@0]L0|`YD0@<]L0q`١D0@H]L0f`D0@T]L0[`aT J D0@`]L0G`J D0@x]L08`@]2`100@32]"`-,0@/.]`)(0@+*^`%@'&L^3_أ@٢Z^_@^_#0@^_"0@__!0@L__ 0@__0@__@$Z__@@`_)[w'ts8xgJo80 `L@`C_04@D`\_2hLg00aT1aoaaJ PO`J O P `* J O P ` J O P `  D!I@``0_0`A O OP2 P2Ҡ0$@ J  J L0$@ LI   LI  J x`AT2 d^HI^  0$@ J  J J0$@fl't(fl't0(J PO `I/@g olJ R/god22P:IC`T DA"D2P0X0R2B  I `R2@0 D/J PaHNT dQIA}@xQ@@pJg PHo@}@x J QB`ᅂUx`U 0p@ 0㘡 p@fl'0xJg PHo@}@x J Wy`yTvfl'8I J BP J    `0Ѭ@DHZZQR@DHZZpgo` @O HO~0gdp @O20 HO9`cOJ2c`OA2dAx`O2x`AO2dA`O2`AO2d)``OA2`AOd` ~0gd2A0{2A0}`OQdy` x`O ~0gd2``]2``bdy` m'0g@o`\%/(2xKLghJFnhl<(80@`\A0@`n@|B `cO`B ?g`O``J O !JO J ``O'Oc^ӄׄe@`T 0)D0@d\ 7  0 p ~0 eA`0s@`0U \2`0N0e`pq2d lP 0`J@`z`]e\@`S ``ypJ D@aS 0 @A"@ a=\(@`S   0 p @a\@cl't(BHC@OANVxKLJ J PQ82oal J XP2^RlRh` L  !8C0U Tc80C0QdA0eG7dA0e?GdA0pc*`g05cQd2. J  8lx 8l AxeC0{l 8l AxeC0lK29DJ J1 \#J @lw'ts8pKLJ APL %J B@CJCGƁN@CqA0f09g@' f0O b0@LeO@LfOO\#8[L@`f BKO  J J  !8JTT @xfO1P`PJ @Lf O H@fO AHOaP`PJ D@eO@e^OA) @*J E J` J ``A᪪᫪80XN! @JS Q J @`2`lw'ts0gJ dQ`g o @fNfl'r@fNA )fl'>`KLJg 2o"0wK  J  B)`l0d1`  J(` fl'ts 2oK`BJ  J dJ `OAP@fNN& >0gA0FNQ`@aO A306HN!@@g`NJ  )`&`J J` J J J  @gVNb J J ]J A )J J gJ D{0HOPgdQ0P 0aJ  I  '@DgMJ` L# `/Bd@Lg 0M@dgMfl'ts Afl'ts BHC@OANVHTAOV!O@T@NVV0xgo090 @xg 0M0gl'08"`"`hK2L92*$Zj0 ar 2`70 # ' z``Gb`- a a aaX "B d}W K0@d K0@ds K0@d /@a0gL80 DK0D0d02![ @!@0grL80 dK0D0d0s2"[` = K0@dp4 K0@d/@g!0I80l  @gMO0 lPK0d0?2`Zl @IChL2ZlC0 YHC"Cflw'ts(goqN0d"`fl'go0F0"``d l'pK2L820"c7 J2 l S`llallaA2lY2`ll lc2 @ l0aT2 l!`J2@ lƀll4l 0T2a!`J2@ lƀlla2lT2a`J2d l`dl``dl`d0dF0`d0 @\#0wJ A@1d2`\ lQ0] @A0"J AP @aJ0kDl'0`KL82 DK!C G0! Ay0g@CHC)`1`4 01`+g0$d0J B!% 2 `[D0ASccD0 dO0G0fFA 4<2`"LD0$A"D02`[\2l0```AbM0NBglD0O0@e|0ge'l0O0'lD0O0eD0e`|D0A2``#eD0 0eF00dK0)PJq `u80 D/P0cD0"C2!OP O0 Q0NASccu70&d2 a)`i 2Zl!] 0-AScc0O0EG0J 0`@HhIJ BSP`J@hh"A2B P!nJ` L#" AB0th   @xhI J  !`/lw'ts J B!`g o @fhIfl'A 4fl'pxLJg $B d@ohkIJ A05Q'2 A`#2` @``0` ` 0@d0AB"`pd{0A`#d2`r2`c d ` lJ T0BRdA d6fl't@68g@ohhR@2B P!n J` L#fl'AB0th fl'<fl'J $B!`g o @fHfl'"A d6dfl'HJ (J $QA c J (R`Q A d/A `LL (agoA ʮA0bb`бfl'tJ (Q00A JA0 0RcJ (QA A0RcJ (A hxLJg $To80D 0L0 D0 J $$RT/`fl't8pLLg ( o)@h? 80&L ( 0 b fl'tJ@ (h0}Afl't0LL (agoA 0 J Q @h?? ! @h!QAJ J (J` fl'tpLJg (o00 L (b0B0a b`б` ` /`fl't0KLJg $2 oL@S (hc> !S @h!@ 22/fl'tJ` $رs`xLJg $80 Fo/f2dl (0N0d`p[q2 P JV2 llTJ $R0J2 gQ lN0A0ad2`r ` /l't8`KLgLJ` $ (&n!odD @hF` @hR> 0` @hF@L0F D0 0 J (@ThFA@~0 `dh00^0>^20m V0#D0ZP`Z12P J)B lZv0SeA0lP2`Ov M|0dA0lP2`Cv ;002`?0@pA@<=XiaFN00e2`J $$R dTQL ( @h= ! @h! @h`?P`G `r/mfl't0s HTAOV!O@T@NVV0g@oiEflJ ` L#'xgo80XGP 2zaP d g fl'08xgo802`fl'08xg)[80F0`d J ,$p ! 0 ᣆJd pJ ` pJ /c) ['8`KLC~2glA2G0;G0:X 080dcU`c2O 0dY`X\2e0R#lX`T#l #l M2^C0O000 dM2`S^Q2HJ2!lPHBl) P[wBlB0'ts `LJg , 0)d[10"2p``O0050w )*qZZB0L0QJ QddN00d0? 5 (O"o ᥆JJ  J J J6 |@)['t pg&nfo`107w00p`O@`V0 5 (O`doml'0pKLJg) [QoqJ tP^RR᥆J ` ᣆJ` J 0^23Wl80C0 20V `T 0 dM2`^00D00d 7dM2 `^DB0M᥆J J 8 J 0 ~0d08RM᥆J!`0 J 0^2Vl80C0 2A8a`0 `T $m 0 dM2`^00D0I0d 7dM2!`^DB0MᣆJ+ J ^2lJ 4C0S 2AXa!0 0``dmDD0MᣆJ1`S0 v0d0180AeXaSMᣆJ)`0t)['ts0xKJL ` xGJ \#|2OK A@8X *J B@CƁJC@CN0q@AiZA8@ f9^C C0aU 2D C052 lL08 8K0L FJ  V 0@Le0C@iCJ |L@`f BKB   J  J \#!JTT @xfBkJ J @Li B H@fB AHOTJ D@iBA<`Y@C/J` J` J  @`2`(lw'ts8pKLJg ) 2[2 J QoqJ P^RR᥆JL0`!ᣆL0J!) ZL0C008J ,"0 0 0 0  J` 0K0@d8ar(`!@ j # N0PL0d0J ,&0 "0 0 J 0@`a8@DgAJ x @JZC0@80a@2AbM`HZ@0a|006N@Ab0MW|`'OkxQ >I  N.`G0`Fm8w'ts `KL922`24(0 01 `X  PE  C!`JV0^C0!@dԬ1  9 !`A`2 `aTQT@CIC `2aTQTBB 2!TQT &0gq"cUUTT O0C0``X   { O0C0`b q^@Ҡl 07aO0C0` @00`ZZ  0d d*  @m35 P`6 P2`ZW  R`  8  !`2 P0D0`a0D0`  D002 "U  0D0D00a0D0`@0n"HD00Q ` pa5d l/ @8n4l't0s(pLg@o@n,L |B80``O00  Ʀ@Hn`046  4A0n[ +` ```D0`I` ` F` ` dJ |B l "Pg`>J |B РrO P!?gJ B0 `"_qO`J>l't00`L 2g o20@Q t)0`D0`Q000_٠.pl'D0t`` `L 2g o20@Q t)0`D0`Q0005٠.pl'D0t`` J` L#J  J` L#J` L#xg&no~0gda0`MF0Andi`J@cp@c@c0@pa@ap04m&l' `8pKLL g o!K  ` 2B С J` H`'W & `fl'ts0JL` gJ` o H`7L # HAJ` I0J d Z R Pfl0g' tPC`Jg  0Po: 8J  -J" SQ 3R 87P .0 zS@lPR+@P 00"J 0P` `fl' hLgfo(010 2D p@A2`db 80 _JL  &H`'P  ( #H J Qd 000J RJ6 @;' J Qd 000J RJ6 @ަl't(l't(pLL 'g o00` 0D!B0j'fl't0xLL g'o  ` F0d `P'fl't8xKKL  g@onX)L @n cA @nA)aD d`R`F c @`80@ddJ : 0xTT V8 @! @`2`H`fl'ts8xLLg fo@A2`Ba @h`ئl'tJ A`8#@X`J QJ d"0J R J0 @ݦl't8`K2L!00C mX jC0C! @n1\!([D0K0` hqG!T2`C;ae0K Ca b#\ lQC 2 B2l`0D0C)`*qZ00[``+`  ggt8C#\ C:0 g> 0g "  o  + kY 8C;aC"\ Z #aC"\ `V ?oS 8CCaM!{Io aC 8B?o? 8CJa#};D0PRgh V2lZR0BZH 2l@0N2lZ`A0'2B  9 loQC C  8C9aC"\?o` ` `0 C t C `8(`*0ZPZh lHaJ` XD$,ZZQ l lH a J`/(Z^ zh`S @n`.0 ,ZZC 0@, 2D @1n0c. bS @!n/J yQ  H@n// J(Z 0S0D0a c(O/ p8Tp4aC  u ` c)`[w0'ts hLg o2)020 2`$l @n @o!/` '  0[8 $ld7`fl't(hLgo "206r(0!4g fl't8`(u00 d $ SFP00dgG_2b@0o0Z"Ph/ d  @`Q0g  2b@0o `Z"PP/ d fl't(`KL 2:2390456 `O0S05vg? lw'ts hKLJg  fn24J J J @cJ IH H\`A P 2*QZJ \ZPJ` C0.`0 ``/00S`Ck`P`/I G`ZIC  "6" C ![`/F0eg0@Gp F0d `# P@C8 2J P^RRF0dxP2N0edg1AGq!008/r`CI`  B  : T8 ) +`V1`:C` ` s` Y`k ` ` `!z ``b/@`*/0g00 W/J` Gc!1Y0 JJ GZP/0d"!0 <@`/0g!0 2AR10g !2GGxP00 d]2@P0o0-a.`@`.dD0k 1 90 a.d  @`.01 g, 0 BGARP K.@`.0g00  ` a.d  @`.01 g.1 GSGg1yP00 df]@`.2@0oP0-au.@`gq.> g C`H@ ~0g8 J J ARQ%i I @ bJ PX0ZJ d `IAF J \^ > @`.0g00  ` a.d  @`.01 gGG000?2 'PRP@0o,0.1 8`-.GGyP2`C0?Pp0F0 eV00C0Be+) -0ARP0qP-N0aeAGC1V0!qe 0-C a*L bI \A^GU d` ` J ! J dJ J @C0m'ts(xgo*`@8oL @AG 8 @@o3, `@80 J` / `/HTAOV!O@T@NVV0hLg00@oPos#2B  ` P!n``)(L ]"@0D0[ B'V@Xo `80``L0"@/=8 @lo+`d @Q 00`=80@|o/J ]1`@o/&2 80@o/d. 00/`& L000z[~P2&2`0 R``T0 R 0`B L0 d l` `0-fl't0(xgo 2`O P``?80@o0l+fl'0880@0Hp 0]+xKLl@XphN+@lpG+@!p@+AC`np@p1+ACޠnp@p"+ACnp@p+@!p@ap@p@p@!q@aq@ q*  @0q:a*d(` /2Z@{00qaKl*d[/@8q*`0@Hq!*flw`'ts8pLgo 2:0 @ n*`, P``r0> 2@q&dL0*  Eg00d 0``:8@qm*fl't00HTAOV!O@T@NVV0hKL 00)0278P 8S0BP P @(s*B`JC T @Xs' HTh AO`dP 2HZ l"HZ lD0 HdL08 @ts)c8 @t@t~00gd`c0&E 0@s 8T0RZ0!`0򼶱F0@s)/0R80HD`m&lw'ts(0+@czdT,pL 2g&noC80T0@esa)N00df갢p00p𡰱@1s)@,t^)` 2J Q^RRB@t# BHt BTt B`t Bht Bpt Bxt B|t` 2J LQ^RRAtZ AtU AtP AtK AtF AtA At< At7 At2 At- At( At# Au Au Au A u A(u A4u A@uC` 2J Q^RRCHu( C\u# Clu C|u Cu Cu Cu Cu Cu   a@u @u @u0@ v(%0@v(A@`: 80`0@<@L0`q``05` V0#HQA0$s0<N0"0*P`05`7+G`)[w'ts xgAow80 ` A{0 c`fl'8g o2 #P   h u A@{{@{$` @n$`fl'g o2 #P    # A@{{@{W$` @nN$`fl'hKL@|$ `> 0.82wa&S#I O: 7H H8O0@Ad|LK3w $ ضbzwﾭ@} $J $lblT#lP`$ dL  . lw`'ts(2 2J`Q0f@C 0f@CK` CfQ`@CPf` cpKLgFo2qa80j6 20v60D ` T0:RR 0i6N000dD0 00 \``0N0@dad q0N0Pdd i!d@1 R`0N0@dad^ WAQ02g(MR!d@PX `` B`@!T ;v0d00u 3pa` /0d0i ' ``r 0ڰ d0Y p` 7d00M pa XC0` cl'ts0xLg&no 24* PA`pr @D}" ~0e0`01 @T}"3 0F0eⱯw2q@h} J H^P0pp0@t}0"` @n"`mFl't8goJflP!'P`L 2gfo10*0Q ƁƆD0AVF0S0d`}QMQ l't` `L 2gfo10*0Q ƁƆD0AVF0S0d`}QLQ l't` hKLg2(`FoP``o6(0``i600`` c6A80~` 6w@b~`0"00` A`l ,6w@~`b"`00a80@~!  A`c l'ts('N@n!`l't0s(2ALFEgo@  ` @J0!`fl'`KL82Aapx 2:ZZP ` Zb0``c :2Z [HZ Wc T `A`A@"@P3!`B`` b`* +2ࠗZZڠ  d$ @`!'G0Q`ڠ@00S!ؠb0aQ dFex W0!JPb/plw'ts hg@o`:0x ``B5 00 @X AtP ` r@|0!@Ḁ @G %B ``5(0@x7 80%3! 0 0300003! 0300Q0  @! 000 @ @04 0 @X0 2b@|w fl'`(xLg oJ D r``P4800 `> 0 2@ᔁL0q ׼ 3Ǽ 㳼@x 0` cO"J` cOd 0``:8@ἁ? fl't08pKLgo4"23` 4c 0 jJ |BaРP80J2gg`al B0 Hg0  0 0#0 d!lJ |B ! 0 B @   @(` ARdAP Р0  @T/ @ᄃ/`fl'ts0`go 0F0dg00 0V0dq00p D ,J  xS@00|B `0pa{ d =0d `@8nY Ã J |B/A@ᬂ0a  @Ă4`m'0 xKL:2!2N0ad`803b38B08TP QD `Ya l` `N0adD0`J30b<P 98C 88IP |Bg``al gѠAP Ig   ` d!lJ |B9C   @Ѓc `lw'ts8`KL!0a80{1 2D `U v0`fd0%0R`20B08FP C A ?O|B6 lD0iaS12C D00R`280b$P !C 0 0C0R`20ZP   2`W clw'ts hKLgn 2:04A`{0 A`w'  ` `A ?K`h |Bs,A@ ̃@00` 0B00 `padrD @8nd*4 Z/F0dN0V0!ed% < @q A@ ̃Cp|BpRCM@d0@8h 00pM `padp P `kAd L0``1 @l `Y A@ ̃@ `J |Br`h @lf6 0B00 `pandrD *@8nM# F0dV0e @ᘄ` 1 @nT h 0 2Fm'D0ts(pgoV0dg2Bd00p  ! @|BSd00@ᬄ0# `/ @Ă`m'00xKLgn 2:04{A` JF0dN0V0`ed % @`f C0|BRCM@d@q2؄0q2*  @Ad` !0``0 @l `. @ `J |B2gB0`7 F0dV0`dF @ᘄ/𡱡 @n/;&m'ts8g o``P0 @l `e` @ `\@|Bp`fl'HTAOV!O@T@NVV0`KL  2"04```N082``H0(0hZPqaf'@n&mw`'ts   lBhQ``ࠂ` 0` 01 , `R`0 2O0HCN0d0 06J @D0(/xg@o`0)K @0d P`fl'`8`KLJ  0PJ J $J d *0482SH2```/82``/80hZPqaf& 2@n v`  lBhQ` ``/2c0`O0 JHCN0d005mJ @+C @ 0Gh !iqZZ@(:d lD0@0 h !iqZZ0g@C"^ @8 @IC< lD0P`,S J O0J J $J dS`&mw'ts `KL 24```.82``. 0hZPqaf%@n`E  lBhQ ```.80P@g@ 070hh O0HC~0 `d10 0I D0d0C0 `+2 dg D @`b @ _K0~`lw'ts `KL20ggFo:04```. 0``|.(0hZPqaf&@nJ`6  lBhQ```Z.(`` ``N.80 N0d `1`C 00H @| * dag `l'ts `KL20 9241J (TJ ,J 0H`. ` 00```. 0``-80hZPqaf%@n`}  lBhQ `@ᘊ0^2l`C00 26H @᠊ R 0@NἊ  @NĊ @̊@Ԋb G 4Q2 @N0Gd`- O  O0@qGD0006+H @|-G Q/ `lw'ts gfo0q10`.l'gfo0q10 ` l'20RaP d0``8-02xg090PQao  d0``&-2 0``-0`fl@'gT8`KL:200!0K+80 h00㹽 ^+Y \20(0G0000~+800z+8 00㙽l0LJ Q^RR `@ N> ` ( 8 ` " 0080 0G0l0(J Q^RR/` /`   /`` J ȶSCl/@0q`flw'ts Lg2 `ot @nY`% !`[  0 0  ` a a`K @` l't2gfoA ) BЎ @Ȏ 0@Ԏ ` 2 dA0dhlB0'xKL"2go802`A Ȏ0"`ü `!d  0AЎ`㳼 ` d @ J ှ2ZH @(0` N0A0ad`+C `l'ts8KLJ 8 ` PO4 8@HT `"P|@X`\2lT0@ meds n RC 2A@tЎV  @ᨏM A@ȎЎ@Џ 9J 4x`' J |BذD2@`ml`[ ycBؠQ2l`IJIPB`lw'tsxgo] -J 4` 80"hG A@@0UG 0H 0P  `fl'8pg oFxj rV J 4` 80'G 00{I 00Q  `fl'0`KLgK@&o Da204 80@8 g  ```* 0 \J 4`< 00QF A@)(@ 00O0F 000I 000{P 00@ 00<~0d1A0$s0]-@e0 @l 00  `l'ts C0 `T#@1L Ta1J C02` P lP `TPaTJ` TJ p]J hJ `J T0 I `JJJ p]gJ l`J t]RRJ lJ pJ TJ XJ p]J \J `J dJ pJ lJ XJ TJ \J p]J dJ `LLg l! oC 0@J H]RCb` J D]P` fl'tflJ' H]Rt0RxJg l]o J y]P g fl'8L 2go l` fl't`KLJD x]D]h`2IO` l]y]8aJ @]A]g2RkoDB `u B0gL <&~ !`g 0ga )`^ gg@Ca 1`Q 90g8 @9`B 0Jgg x] haA`1 2g a I`% 0g"N Q` 0ga Y` g a` a `K <`!20ee l YZ`C0z0dI2e l[lJ x]P wC0'ts xLL <eg ` N!`aD0odJe x]Pfl'D0t8xLL <eg ` Y!`aD0odJe x]Pfl'D0t8go fl'flc'`KL@`:04  `O0 ``' r```' "`R`' "s0@1P˰7@Pðyi`A 9 z@ 2c'DV0`#80zPP# +`` Q0 D0008 !"0L00|uQ4Qf2^0l'DD0!P" 00 0 0@ ] `"DN0P A`ᐠF! 0dC@ 00`^0 QA0ሒ0.*@e0a !@ጒ2J h@JX t]@Jᄜ H]Jh` x]J` l]J y]Ja D]J lJ pJ TJ XJ p]J \J `J dhk@Jz] @]  /C%.T wC/T gT0|CIJLHOKBAe p l XT\ p]d` 2 82 2 827,CT02T HCyCPqCgwCg7 AQY#C\0T oCL0T hCT0T axCqCPP`TPaTeSg _qC@gxCQXCBQ+ C0 T ?[0C"D0 #SH@]2J z]l ApCEQg C T `TPaTe Co`82 d0 2J pJ lJ XJ TJ \J p]J d$2J `C0[c0 C0C!S0v 0z"Bn$22.``a e 㩮d#d0A@`00NF0!QA0ሒ0v(@e0 L: D ` @̒,` @##`0q(@P\r,>PT `/w7-J `J hS/)H[w0'ts `KLg)@[D:0*2B Pa` `J ж h 2``P$2@Pc`` (V0#@F0'<[ZPdP   S gN" 0K0Q0 2 D00  0L0Ƶ0P> g7" ,, 'íS@d00t7m00@#V0QA0e0'@0e 6b "0J ж  dAQ0S(M R!d@pa'(D*0Z[1 0J ж80 8C8C .  * Q`j`V2l` DT2 'j@(Q   l(ZN2 l`T2 D =c`  1d d> @ܓ` @0J D`)D['ts g o ``P#J tJ t@᜕fl`'`Lgo 2"0t @n`, ```#J tQ``#0000` (0P@gᴕ0q ``#2`l't `KLgo :0h ```p#2 aO ``e# 0 ` ``[#00 `C 4@Bܕ0,S20 (PJ0 @\c2>0 ": @hL0Q$lD0  C CC/P`l't`s pgo0090! $Q2qae g  !s!d c c ` ` '`fl'00hKLgo2p )0 @n J ]TJ ]H00 !` 00`X`"J tP 2J IZ J JP Z)J @Ve @ᘊL0r `@@!  @!H @!(Z@Ԋ2 0  J GPja   C 02 GGN0ad0`R"08 `!  ! ! 2 [/` J ]TJ ]`l'ts(gfo0q10`>l'gfo0q10 `0l'xKLgo 2 @n > !` 807``X! 2``! 0  ` / `/`/ ` T2 0 g9 / T2 0 Pg9 /T2 0 Pg9 /fl't`s8`KL2 ` @n B !` 00;``X!82L t``$!(0`ؠ`d! 80@P?  22![D0Z @@d. C0L00? `G @~ ? I HZB JP Z(B ZI J !JP Z(B @D0K00V `   X  X 2Z[g? `flw'ts pKL2 ` @n  8!` 80 h L`` tx !P2`` 00``d I HZB JP Z(B 2H"[ZB >JP Z)J 5@xw hd !`! !@1ᰖK0 Bd h0  !  @1< ! 22lZ[ hO0 `Bdh hA@ l`@AO @tO0B @1(K08 h/lwD0'ts0`KL20ggo2t @n  !` 00`0 ```* J t 0`` !hK80 ` `ࠂ` 0,Q2 `   2Zg9 `fl'ts `KLJ ]TJ ]2J ԶR 203 @ n H80 !` 80` ` `X`J tP 2``@^2@ᘊlL03 J` I Z ,(J WJP Z)J NF0dL00㬰~2l` ` 1@@ 1  @H @9(N 2Q[ ( ` 1!@@ 1  a@HB a@9(IC) 2Q[ {2` @0 h hqZZQ0g@C"^ pa  @IC< lC0(P`  M,S bJ ]TJ ԶJ ]&mw'ts pLg:0o 2`[ 00 @n! ` c `R`P80 @  d07 `fl't0KLgo 2t`J D#  @n c (`x @@a ` @dax `fl'tspKL 9200@`:03 ``zJ D   ,3 ZaP@AJ0 B0``^J D `X`SJ D@A"ɰ @9n  0 00` J  ~0d0b@Xd0qJ  ~0d0O@dd0^J DP @xJ0PJ dP @ᄜJ0BJ B ~0d0 @`0/J \# ~0d0 @|d0J  ~0d0@ᐜ0 J $P @ᘜJ0 -L D 09@x AnA 0@᠜!h F0@e`G0 `B `mw'ts008`0 `0`0`0`hKL 2go10 a l50K Z0'.0b@C d  Z0b@Cacfl't0s(`L!2go 0*0`1  9dJ R0b@C 00 00`0ddJ R0b @C d/=`  70dJ R0b@C >0/cfl't0 Jg x@o᨞e `fl'hgo(0`  %dJ R0b@C 00[ fl'(@70dJ R0b@C >0/fl'`(`KLj`202  0Q2a"l2WG0  $2ch @Ȟ: \2 l D0`RG0 0c2 l  AG0 AG0 ` AG0 ` @O0!`m!2 Adaݬ 62`R`'J80` Q(`  d(`"l@,0/@0P05P)i`HCS0 d2! l D0 o `  P l @C /`AG0P`㌬ G0N0dR`dA80`pm 204 2.0Ed 2  l b2 lB0 G0080d2`)ddQL0 R!P @T@/ lx C 2` Qa a H l C  d"l`A` 24` p0N0d`Lq2P Jd0` l2`㷿i A` /2``2P CH0N0dR` q2@CVP Jd `T@OÄV OT2C@NAVVR1 A`㨫 Aa㞫 2@A"h `/0/2``J D`lw'ts go 2fl0' 00!@nfl`'gB&oᄟV00q``bdl'`KL r`1 2hh$l dJ R0b@C  J R0dbCIP`D\ @ጟ& hg >0dJ R0b@C 70/@ᘟ0"1hN $`c/ dJ R0b@C 00 000a J R0>0dbC70P` =0dJ R0b@C /0/ @o 0 ll$lrflwC0'ts `KL 4A2̡`20㖪|0 'd` `g'2`L2A!l`~な A`lx J r @n*!I q``0`ࠂ`(0 ` h ``82)` ``` 0 @ԡK/` 3UqJ QNG0QAC0HgHNP p@1 K0hD< J ,6C0 N2AmZP8 lZP @@`@2Jᅔ 6%27@Ԣ 2 40` rIiCD0S0bH80 @ @8D0HdCldO0!P HtA@H`A  . % )`+H`, !A7 a, !2 @- @,( @<# @H @` @t @ሣ @ᤣ @ḣ @У0@L0z @Ȣs` @8nGqJ QJ  60mw'ts hKLgo3*0``#l  \a "\ l`:d l` C%aC d#l P`fl't`s(g@AoOfl`'2C 1aJ`  @x0@ !AxP1 0Q0  ``Lgoqa(0 080 SL ,`d0 0!0㢨  wdd0lJ T `fl'D0t `KL,217!0A8o@I0426pc 0F (0` P2@x 04I xh lHaJ` &(lZ^Ql lH aJ`xh`G )lZ`^, @h0 +lZ`^G +I*lZ ,hZ hT llJ Qd O 8C aJ`092B A `S V2:C`l^0'l2G0{Pa 2C 60qa 080 !2V2l@Z' SK ,h 002 hL0D daDV2lZ!2lJ SV2l^`D O U L )qZ^gP 2K`0 f`6 L hD eD0+QZ*p80Z IP d l l"Dz0AA T2`/ G(0Z^0GR 0;P"20h`D 3{PpQ" 8`Vr ,Q 2` ` dC h ZPlX0a `Q0Q R$8`50617K @82@f'N2(*l0Z[$ K0Q7P"M @@`@_0C0S @f Q @@`040` ` `Y0 RQ/)[w'ts xgo902B fl'8xGg@o0ḟ@0ᄟfl'@0L8`KL *02``#l A@,RMл@۶mҹ@ 2`һJD"lDf0dd2 ddҹ*0 bYd B ! d/#l$l /0g 2$2``#l/` $2` b`  0+d$lй`* b 2D  a+`  @ `P` @#`d#lt0s KL!2go2D (S&B ` b 0J ^C TK  jP j а`@$P cfl't0s2Q J ^RҮRc2Q J ^RRc2Q J ^RCR2Q J ^R0RRJ |0J xJ` xq`(``Lg o80)0 + ) ` `` 0" 0 2Ad04  T fl'L0t0 FdL  $  fl'tc xLg)[)(qZ*[80#<F02OPD02I0L0z)(['t80hH`k0,Lg)[)$qZ*[00D0 0D0)$['tLg)[)(qZ*[1M#40F02NPD02ID0)(['tpKLJg o 2h`` J 0{ 2HD H zdC0 D    0``0D `L0hJh@|wJ  @ᄧj @Ad ]@ᤧ\J Q @ᬧO @Ad ]k@̧AJ  @ԧ4 @Ad ]PLK ض  AdJ ضblTfl't`s0Lg)[)(qZ*[1M#40F02NPD02ID0+)(['ti HC`I0+hH`2+hH`$,Jg | o(   J` x `fl'Jg o fl`'Jg 0o` fl`'xJg ضPPPPP&noa J   A`c3 ~0P!gd,a`0F0Ad2`J@|!@!0@|"@!p0`m&l'8I P 2J 춂ZQ 2oI H 0L2ZPH cTg cTg `( (   0 8 J  J ` J / J /`pLL 춢gcoRUR!P`Ng`  2`NP+C 8 `XR0x` J J R2JQ >RJPJ 8R` `fl't02KLA 2K coC0L2[`HTT!HJP 2APDѼ0JJ @ tJ s|Ha2PDS2BlQ ` ¬ʼ` 2ZPH PJ Q ȼ 20J@Zs ᬢѼ 20J @Zg  NO 2J `@ZXVXN ƺ * !҇e$ `  [ T Ƣd T Ɗ w T #~ r |P@AP2Q  `@XVQ2X QHcT ʬ¼ȼts(`KL ,"0Yd` ` cAU! 2J 춂큐ZЬPP2BlЬPAcAT!80dM ƽ - !Յe' `  [ "T ƥ n #T ƍ w T "~ g u |P@AP2Ь cAAT)R{`  A2P:0dO_2ClXAcTjRx`  20JJEZ 2ڼӼPZ@0@d! ۼ 2ZPJP/  NO 2 `@xVZxO ƺ + !҃e% `  [ #T Ƣ n T Ɗ w #T !~ r |AP2ZQJ 춂 `@PVPQ2 QHcT ʬ¼ȼD20 dM `@Q I T cU O T 'd2709ZP2Ԭ acTRy`  a2Td`T T2Bl/0H2`T oJg/2 OA   &d O T >0/ 2CHTH/2cYUnRx` J OdQ88  PƠgO0ㄝ8 0{S0rP 2"tJ PD027PJPO 88 | D0HR P8`CT ` @`RP#2\0{P P`M`ORQ0K8 0BJ 28PT0R8P[0J#`x` ``+ 0cgAT2XIVXZ(`Px` C0@dBJ J  J  2cPThRx` 020JJ2PB0BZ2I.Ѽ 2.20JJZePȼ 2ڼӼZ 2ZPJPѼD0f.`flw'ts `Lg o00`@` fl't0 x` `0Yd` ` cUd&P g(0B 20> o$QCgUgL0Ry` 7P8D0Rc`TR02P2JIPJP`IV`0'2c`T Ry`  2JZP`I VBl`B0D0@d `fl't !PƠaO 0 pKLJg 춓@80o0^: 2h3 D 12coPPTZT 0g a ` L2`T2`J2 `!l !a PHBlAlPHAl`Q2HP D0`qfl'D0ts0`KL 082`f!G flw0'ts 2cYdo\U` ` cAU 2J ZAH 0L2ZPH5 cT0zPd2)RJI 춃ZPXI(Vs0X!Ѽ h`H2c2cDaAT@ YHPNQ0dQᬢ0g at0 ѼFd*` G22W2x`B2 Cl lP !a@ Bl`Cl@lP@Cl@lH2S2@XHP 0O0{2,RJI 춄ZP`I(V` QѼ Q9ᬢ0g!aD0 Ѽ@d*2` G2W2`xB2 Cl lP @` aBlCl@lP@Cl@lH2S2@XHPW O0)S 0 00w2XL2oZQHcTQc2? 0g a 0` G2&2"22O2x@`b2A2 $l lHP!aL2P2@ `!l"lDl@lPH@`@lDlH2T2@`HP 0O0ܝG0- c270x`nR `2I(V`Z20JPBZHJBlHB0 2I0V`ZPJPt0Fd cTQ.flw0'ts 0(  J 2Z0(  @Pg0( o0 2J ZPfl@C'` 2KL`1r 82`hJ dJ R0b@C 0a00 S 0 80G G0)0W0' "2o0d q@^ l qC000^S!2`8K0D00= 2S}QZ*4[D0  ` ` @`lw'ts `KL82)020 0 ڠg3 1 /* ( Pg $c2l` B g  G0HC00` _0HC00 `d$lflw'ts 2P2RR9 20 `  JR2gd@P2d2R2RP: 220 `  JS 2gd@@YP@0SpL 2go90f  0# &   7 g 0PR`〖 'g`fl't0`KL821"0|e0d` * C0=C g dQS0@AQ0w8(MM8R  g dQC0@AQ0a8(MM8RSS0 rP@G0d UzР0Pа<    0 8 2d@@(P14 2d@(P) `zP<00gg@@J0dPQPR d@8$0 8 2d@@8P1*$ 2d@8P@`ەzPPP` `flw'ts go `Rl'L 2goD  qfl'D0tkfl'tpLgo00780@`3 2D   D0'f 0KD0H`fl't0xgo80`2A J@ILTS`PаP`P `fl'A080f0K`PC eCf P@C( C P P@C(c CHfxL 2go` 80  0'P cfl't8`K22L1 !Sz0d(C  2P  0d1 0820f@CJ`70 d 2J Q^RRc 2g`# 1g `  2g`t 1g` g 2`,` 1g<` ] 2gD`` 1gL` ` 2d[0 0E 2@OP[d0r 808&2@OxQlD0f 0,EP9P|0O0Qdh 0U 0QdZ l2L00D 0 CIC@Cc T` c `01 /`/flw0'ts hKL22"20 lPaR  a!HPIC`) 0eC!xJ2 lJl`SC 0fPCM`( J2e@ P@C( P@C( P@C( C AP CIf0@Q2Q` @ P2 lQ C `V``P J2D a` ` aa Cf/ts(2Aly J $R^RR@ᬩ( @ĩ# @ԩ @ @ @ @ @, @<J   A@gPTFo 0p@\ l'CxL!2go` `Bd  5 (O  `fl't8goJ RN0ydP l'Lg o!28L  g:b`Pb`Pb`Pb`PbA`PbA`PbA`PbA`P`  d8 fl't = OЎfl'txKLL  g o b1`Pl` h`L bN0ydPa 1 d   !`` d  d   ld[ c  b1`P-c O = Or L bA P u !  D0 d2`  N0Pyd l\dL  bAP E  bA P 7 X@C!c>  !T2``"l D0 d AO BQV P d lJ  XC c c ` J RA P j/l'ts8`KL:2 0)0h  ` 80kI  PCV` 0d    3  `Z oHA `ZJ  u  qJ P  bRR] g@C5J1`P D cG' +L b1`P  b  ` CP d hb801`P`  cL b  ` CP d  gK/ Jc ?/ J   L '/N0!02 8R  8P}S74 `7 @2,4[ADZR ./ !lZZ0 R # d:0)qZ^R sP`09@0g *LZ)mqZQZ`!l2 P`%2bB /[^^ ld 0 2>2(`FZ, ^`Z_080X18)C7k'l@ONZ27?ΰ0`10g8 w0rlADo0(0ZZ,`Z02[1Hp dhDqT0 sZ220<0 `g+0@d l l 20&2Q R0Q " 0 Rg 2<0 R"l d:  `@2v50d񼐢0B`b2B 0t00Fd2`P2> l0tB cTV@MyC@OHV2C00P@OP62C0P02'l[2"lQ=02AZx/3.c)[w'ts b00JchCQT@OV P@O!HVC01H@ ` @BPOP22 R5 UZpg `@S0dp T [0X N T 20`5c0@ YgT2M5.1A c/7t`C{/20q ! 1 `0AC@M@OHV l30/+0@<0+/1q R24s7r PADZ0yZIAPIC@OHV l10~/`/1,4[/D^ `Z01P00103@gc0oToo01/01pd1 l!lp01qr 3 `/c/0X1vGc/hgo8010*0 ``b2B `Ufl'B0(20 0`RRKL 2go22 !0g10`!` `B ` ```bB fl't``sRfl'tsK0K0`K0/Z᠘Ob!/xLg o80cl't82­B AA TD V0D00bd2⢊RJb22L0"@Bb22ʭA2J0`a2`ȱ/2goB lc'ѭA Ƞ` `QV0 HJ0bd]l`'hg o(0cfl'(2ʭB A`@``P 2J c/2ЭC72&` 2  !` ` lgB0xR 2PJ `JCc/R/ d/ 20N2 2`Vʭ`/2`/`KL 290D cflw'ts " ``b2B E` UհB0g8B" `"@ @x %?b2C #"`@ `0b 0PS0زeC0L0{D03`/bK0"@b`xD0c/`Cа/D0/y`2h4B B ƀF%q0  0=R4z` GPHPPAPPAPPAPPAPPAPPAPPAPP APPﾭ APP APP APP APPAPPAPPgx` lYP B22PYP2ZƀQ3ƀQ 8ƀQzNb1RƀQ O P8zNRbR OPAR0 xƁV(`(`K2L!2goX *0آ0R# 8; c`(;R `8PB `أ00bس"B 00b000È~Pآ3 00$ZOb0>x0=1hy|qBx=YH0p8 1|=SgaHhA J $Z^RR|q=YBG0K0cx80-p 5!r 1sgs@EdW`:`TTI ' Y% %" i@ἫIhgyx/` p !p qgq@WEd` `CƀB# y````y5.=s dggs9hy`0G0K0x]y:0QT-r|B=ZyG0K0A80V-p x' r'Pr'0G0K0x+~; 0R&3Rgg& K&: :s; ;0q8PBQqDxxR y 8``y-q|B=YxG0K0c80,yR-x@OP`# $@`8@ᤫk-8`?8,Y , ,߭z @`8`x߭c,߭/`?8T-߭x N@d9 )-@x:;-`|=XB0G0K0xx80,`|=`XB/1|pBq=cYxG0K0N0 K0)K0IK0xExYq8H0 |=Rg h`y,S5.R/y`,`l2`o@0PP) p }/p yror@Ed) W`2^ 0Q@TP2@0R!0D@Z BSV`HIDI0 P2g !dl-?+xK0@K0/ &q𮲣|=YBxG0K0080)@IhЫy-@|cIhy/0=K0x@ᠬcc/@|cc/( c38000/K00=[0>K0Vq|B=YG0K0cx780L)p@Ih=y|XJ+0>K0,@ᠬc/  1J` s=YR6:|aBP2x I6 4~;DB2oP4@C2WZ2^6HC2^Qa4` 0TO22PZ F@R2oQ40! 0H` 8`~T0R8YBPx`xYp18H0 |=ASg  H`9` *`` ᠍ 0 -3 -0qo0@Ed) qW`2J Z^TOP2 D@ES P0` r*S/!Hb"x`TP`` c* 0gTN hD@ASy ) DR4Q/05!HF@RG1H&22I^TOP2 0/22oJ4 d@WCd=/F@R2oR4H/)H@ج냘R~8`T80YBPcxI/0TH2>0CR@62^QG@p` Y4 2@r`Ad W0#PQ0R 4a00;TO22/0Z"HE@R2H 22AJ^TOP2"HE@R0T 4 0 2 d@EWCd0 0"PR4!0022T0J^QTAHP򢸢R 2 22DH2H2 l0 lg 0gH P0R4050N@R.8`T80R~YBP`x. 0 ,0 ,p1g1@Ed* pW`2J Z`US^LTP`ఠ`T@ ᠍ 0 ,0 ,p2g2@Ed) pW`2J Z^TOP2!HD@ESx`TQ ` )@}R.1H+P(RR 20a/ 0gH PRT/pR)p|B=X~G0K080 ) Rg)H d  I   @08,@*<4[09TZ1:@`* H`*p 8`h (@*`FZQZ!@`Bh  dF28`(@[(@᤿@ IZ0 D0"qh(`L0h I @@(LZ0 0``1tCJ`  1H 2g L3  " `1hNgxy1H )H 8` R(H` @ج*|p=BX,FIL  /(|=P)80(0 0Rg ((0R/j`P`O`pKLI? g NHFo 2.J? P lW lQ lR lSVyVVYVV@C D0I02`k}% hZZDZ2hl1PAX `JL  @ J LP0hp/l't`s0g@oX@xfl`'J 0Q@gg oc 0^fl'go`uJ 2TJo`VBJ \ `lfl'Jg@C o0$@ J PH J PH J P(HJ Pfl@C'xg80No@Cǁ@CflC'08pLJg80  o10"20$@ 0$@J 0`` `J 0Q @8 ld7 J 0$@fl't`0LLg  o 0$@  0$@J >`;!!1$Afl't@CxLJg P oJ  0$@ 0$@ `L  !@C @ᨭy֠ !` `J! 1$A AO@CJW ` ZC d `l/!AP2L ` Р%   a! j BQ0d 2 e J PȠ QP 1b0 _CaTQ0d 2 F J ȠHQS- ` B 0 ` ƃ`HC AMBdx`T !M"d`T Md0Hdg`@CJT PJ PJ` ` J  @ܭ`l't8pLgo 220 ` !OQV@OV00RJ  `l0$@fl't00J L `goCL   0$@  0$@0` 0$@`r 2 `Hh `rL0R! @i @`e$c `fl'txgo`r80! J  `   a!  H 8I$ `r8R! @i @`ec `fl'8`KL 22, ` !OQV@OV828 80 @` 1OZo1A08 p @h J P @ @8 K Y@0I ZG0P g_7 7PR_P0yR d0Ry )L   0$@  0$@0 0$@ @PX ]H MJ  0$@ 0$@L `0 (H 2dZJ 0$@ ? 2}SQZ  @h@ီ` q L7 @8ӷd/.J  `l0$@mw0'ts `KL  `0 J Q Ip U1Q 2>02@ @C@qN1ᘮr4s7`J  `l0$@mw0'ts J 2TXJo!VB0$@J` $ `Bo0$@xQ`80Cgoh`J  P(H8Cbo0$@J  P0Hfl'8J  PIL 2go l` fl'txgo80u'I Id9J0 1$AJ@C BBN"l0$@H8L0$@fl'8gobfl`'I  HHI`JT R`c PCxL 2` J oB2H- I Pg `H J  JB0$@J  @0$@`:H- J g `HJ  JB0$@J  0$@`*H1H aI $` J ao0$@"H!``0$@ `8T 'H%c$ "H  df`Hcc c J `0$@`"lo0$@`t8LgLo ` 0$@sNA(dN!T J  ff 8JB 0$@fl't2xgJo 8Hc J @H"l@`bl0$@`0$@@H I Pg0$@J  @H! p"lB0$@0g" o1 ! J  ?`AT@ J `J AH`!`JBV0$@!'@0*`80;fl'08xg &o802ƁxC`F0dpgO xC`p00pF0`d@ cl'8gfo V0e `2IC`@Cl'xg &o802ƁxC`F0dpg xC`p00pF0`d cl'8gFoV0d `2IC`@Cl'`g&o80n0`f0`ed~C`d07t 07t cl' cT2 2#x X$cT2 2#p P$cT2 2#h H$K4222:4AVOD`T22B  R2o2"lo/`2K4222B $ P ![` VOC4Do`T2B 22 2oZZB  2pJg ]QT@OV OAATANVW@0oD@x! 0` cO"tJ` cOl l l zl2fl'00Rp80c@g o10k wP0l fl'wP00fl'02  `% !4@2J |BIA(ZҬE=QZ` B(E=` `0K@CpKL 2g'4F|B"K ]ao"L @0P2РAPC0}tA(E="a"L @0P2РAP APC0dtA(E=@` J ]ƪXO @xc/ P T!@@ᤰ/0N @Ȱ RH L  L@/`fl'ts0Lgos `O L ]b@ 0Π +@ΠH@ ΠH@4Π@H@DΠPH@LL ]@!bd@L0ሱe|`fl't`KL10:23`Z )PP 2aT2T0bd'0rZddZl cN И g/C0q0$s 7Axjz20 B P !T"@ 0Nac@AT92Z2/.P q@1ᔱ00 eQG0 @ḱ`lw'ts `KL282cA*0`ZXT!7NPƠ 2~A`_ G0"pPR0 EQQ&dcAXT!P`M0flw'ts `K2L 92!4 @2J |BXZѠP2a:[T 2d0dd=0ZZl aИ g/N0d cb0F@Tر7t́ T2`U0 80!!40 @2J |BXZѠPO0^00@ 0Q @ 0 @@`A @:/`fmw0'ts `KL 2!0 c 0 A0xjq J ]0Nc@U`f "+4K0I |BO @2eAxjZРJ ]EQG0U7N0O `0000` 0`4 "K0I |B @2`ZѠPP2T!@  0D0 ` 0NPO0/}PD0 `dQ  `lw0'ts `KLp0!22/ 0cL "/4O0I |Be @2AxjZРJ ]EQc@U7NC0O0000 0` "O0I |B @2`ZѠP 0rlw'ts ;lw'ts g@ofl`'J@ 00@(0gP`PoB0 0` @scfl'0C@czdThLL go(0D09020 !`D0'f c `fl't(J R"4 @ 2J |BZѠP`K(0LT!2!`go  ! !@!#  d b c f l s ha aJ [\2 Kl``AUUVU0$RAPORLP25T QiadH`O/]H 5H s SUH H s SMH H t T fl'` D0ts xJg R80o fl'08G@ fl'08xJg R80o fl'08'@Dfl'082LgFoB  T V0a` bd2@OVdD ` `l'txL 2go90B     @Ax 2`P ddg@d2⼊ZB @Aᔲh `PaA J bbfl'tB08`KL 2920``c 0 9 2 @OVOAVOVmi@OVOAVOV Y|0Ge0O00o P@OVOAVOV @0" @Aᨲʢ@ 0@AḲIJ0ʠ@OVOAVOHW@OVOAVOW[C }lw0'ts `KL)g[ 2 0*0 lHyaV0!  PI0wn@ S0f2SdlD0K00wn2`h [ &2 ) ZZ` l0^gK0 l) Zf2Z`dl00L0" (0@Aز@L0" ) ZC0ya" 0000K0 (0@Aزi@K0b@AᤲX) ['t0s 2`KLgTo!0*0`` 2 @OVOAVOV@OVOAVOV @OVOAVOW20 -,@OV.OAV/OHV9 MP DQ028PHC02J Z^RR` 54@OV67OAVOV@0 0n 2` dZ54@OV6OAV7OV t 10@OV23OAVO5V@O4V6OAV7OVH00R 10@OV23OAVO5V@O4V6OAV7OVH000 10@OV23OAVO5V@O4V6OAV7OVH00 JC@AḲNc dD 0l'ts xL 2go WB0~B fl't82xgo 0d0fl'08`fl'8`KJL 21@C I APC01a `ai@`h`u!qNuO0`T2J [@lZQ,uXP 2!@OV!L0B``^١ AOQV OV OQV A@@OVBCOAVOW`L0a:@OV&! @OV"#OAVOW`L0a @4JYMP  dM @OV  @OVOAVOHV``2@< ! @O8VOAV€HVX` @db`( @O8VOAVO@Vሳ 0Ǡ@OVOAVOVdcTEQ3 !@OV)@OVXHP"QQ c'd@T  V00!`d28 XGS %d0 @Aᴳ @1`a _ @OV/=<@OV>?OAVOWD0!DHP102@OVO3VOV`0YdMP j/%$@OV&'OAVOWL0Ae`AQ0 (N!d@.mw'ts xKLg)TA[c3 2D `u )*hqZZ`+h@Z`lPdB ^0'h!D P2813``@2+ZZd102@OVO3VOQVP546@OVO7VOQVPdD (K*h0Z Z[`𰠠0@"J ZlSdl`)['ts8`KLE0M0Alh"282G L0 ` 04@A8 C0!DHP546@OVf27OVlOD0VIj54@OV6OAV7OV2`[ {````y E 2@OVOAVOV1c@OVOAVOV S8%hC "@Aᨲ@Ţ@ 0Dm5@AḲX0n)Š@OVOAVOW @OVOAVOW@OVOAVOW[C hCQ`'| 2 @OVOAVOV0=dD ya` N0G0d000 @Ax G002Ms @Aᤴ`)[w'ts `KL90A 2pA "2 lHyaV0#4PI0;i``46 )4[SD0 006i2`h[ &2 )4ZZ` l0gK0 l)4ZZ`)4[pL0 4 }"F0!4HQ0ya 004 p 0 @Aز-@ 0x"qI1I"22 @OVOAVOV/"@OVOAVOV "qhL: ^0'4!DP 2 @OVOAVOV@OVOAVOVQ`  !D`dD A f2mK0AeD0kh2N0`"[ P`"@.e%$@OV&OAV'OV0@OVp @OVOAVOV0 @OVOVOQVp`008 `07A.E0 8PMHSA.0E 8O@R 2 8O2g[  ]8O2 d [J QT AᢑųD0L0PXMMR82 =0'dAIW0@2|2$0D8PMHRRGR 90 90?d 5$`T AQ0(M R!d@ ` AQ08M R!@ 2J [^7 dES/$g`T AQ0q(M R!d@ ` AQ0_8M R!@ 2J [^EQ a@@ [AP2` ES d@Q[Q PA[PAᢑų dD05#L0PXMMRAለpቈG0W0QG0M/MAለSቈG0a@)x_0qZASA0Ĵ04u*xZB0Q`2B `)xqZA0i`2B `V0#ZPpe0)xV2@qZm22˜Q`%@A*D54@OV67OAVOV@Z 0@Aᤲ2R21A - `: @Aز@L0 @Aز@V0#4ZP@Aᤲ@A`) [w'ts `KL)[(*0Z044 Z`)qZJ"2`@ 22`30dBZ@C2(0ZjC^ 0# P09P2 2Q2 0g@  lP d 09PiCP ldJ0 lP(0Z^l )[ts `K2LO"24@O `ZWO01< 0 d` 2 B` l0xL~LO408`XE@I Wj0 4"00xHP 2Z@@N `00P N?JR4 ly'"0 `h/wts g0Fo0`2F2 Pl dPZ2PC@`Cd 0@0l'0d0 0B^L2 2h^o lA!t24xh` J0dSG`@C8` lJXCIC@I@2 dZ0@082C`J0dR@C` lJPCIC@IxKL!282`h G02d  `8c \2QD"Z bZPH0PK0ZRᬓZD^flw'ts8`KL 2* 2Zb0* [D0 0 80c  d/ V@d  GQ" % P 0D0U0`gJGT#` @gcAV d@ PdBQD0O0~ 00' 0 d g0dD00Id@dHP(PC0HR` 2 d d flw'ts KL 2`` `h !b dAZAZ ZP  lh ^RB ^A⬊^ lSA lb ` 2 dPD"HZZR tsL 2go`b "`fl'`"t``KL>( * 0Z+LPZZ(2++Z2,( Z2-+,Z2.(Z2/+$Z22(Z23+$Z0F24`Z(dp25@`Z+0)26`Z(l0*29 Zl+l(01`2:1;aZFZ21017082<1=f2lD0f`D0; ( v`d`Q2@OQ lD0 2p1F8Pp01Pb8P! &rD0)`r 03 CQ)`D0 0!`D0" N080P-^0! P'V0# PL d'd` [ F0d`2 21+@ ^P2-^dd lN0" P``j f2^0 lCPD02 1A xhA 222^24^ddK hA82D0`1024RXD2TD02*34Z^42;479d0R4 2Z2 Z2Zdg d l!l 20Qd hAD0`ad D09`[XdQhq0S'2N0" P?R ~0^0 dCP02 A xhA 29^2;^d l4 hQ`0(2790daD3; ZP2g!ld 2[l hA0`2l 09`2Zl[hq0D0N0" Pp3FCPF0dc  d1FwQ04``05``02A`"02!@P"pI`02!P`9`02!`PB`A`24```б fP0;0<``)`09a2;V0# aPPN0" P}D00 `  9. C p) [w'ts oM L `(!qIT g 'g$flpqrstuIVqONO`HI $@<#I%`U O#  M L4OH 2`Zh (@-WvJ.$'I I  gTWNWO2$K dJ$543210iJD2Io$hh$/i ` ƋR Cg0'ƀQFXƀQ 8ƀQƀ   0U-Boot 1.1.6-svn1112 (ADI-2008R1) (Jan 22 2008 - 20:29:44)1K4K1M4M$ %`%$$%`%V%`%\%&.'H'h'.'? ????8@@DCTCbCCZDED;Zx0N u u8m.kkkjjjkRuHu\uHuHufuHuHuHuHuHuHuHuHupuHuzuu>uuuuuuuv vvv(v2v2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh hhhhhhhhhhvphhhhphhhhVRhhh hh ^$$Jt *B h:          ??X6T66v7v7627,4<DPXd|/-\mnJanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSatl     <0x%p> { %s + 0x%x }<0x%p> /* Maybe null pointer? */<0x%p> /* somewhere in u-boot */<0x%p> /* unknown address */Hardware Trace: %4i Target : %s Source : %s SEQUENCER STATUS: SEQSTAT: %08lx IPEND: %04lx SYSCFG: %04lx HWERRCAUSE: 0x%lx EXCAUSE : 0x%lx physical IVG%i asserted : %s RETE: %s RETN: %s RETX: %s RETS: %s PC : %s DCPLB_FAULT_ADDR: %s ICPLB_FAULT_ADDR: %s PROCESSOR STATE: R0 : %08lx R1 : %08lx R2 : %08lx R3 : %08lx R4 : %08lx R5 : %08lx R6 : %08lx R7 : %08lx P0 : %08lx P1 : %08lx P2 : %08lx P3 : %08lx P4 : %08lx P5 : %08lx FP : %08lx SP : %08lx LB0: %08lx LT0: %08lx LC0: %08lx LB1: %08lx LT1: %08lx LC1: %08lx B0 : %08lx L0 : %08lx M0 : %08lx I0 : %08lx B1 : %08lx L1 : %08lx M1 : %08lx I1 : %08lx B2 : %08lx L2 : %08lx M2 : %08lx I2 : %08lx B3 : %08lx L3 : %08lx M3 : %08lx I3 : %08lx A0.w: %08lx A0.x: %08lx A1.w: %08lx A1.x: %08lx USP : %08lx ASTAT: %08lx Ack! Something bad happened to the Blackfin! Please reset the board %cCPLB exception outside of memory map at 0x%p ### ERROR ### Please RESET the board ### Flash: ethaddr%02X:%02X:%02X:%02X:%02X:%02XipaddrloadaddrbootfileNet: MAC: %02X:%02X:%02X:%02X:%02X:%02X I2C: ready bf527-0.0bf527-ezkitbaudrate %s CPU: ADSP bf527-0.0 (Detected Rev: 0.%d) Clock: VCO: %lu MHz, Core: %lu MHz, System: %lu MHz RAM: ## Booting ldr image at 0x%p ... ## No ldr image at address 0x%p bootldrbootldr - boot ldr image from memory [addr] - boot ldr image stored in memory Address Data Size Valid Locked %2i 0x%p 0x%05X %s %c %c %s CPLB table [%08x]: InstructionDatacplbinfocplbinfo- display current CPLB tables - display current CPLB tables none%d%d.%d.%d.%d## Warning: gatewayip needed but not set bad length %d < %d invalid RARP header len bad %d < %d checksum bad ICMP Host Redirect to netretrynoonce ARP Retry count exceeded; starting again gatewayipnetmaskvlannvlanserverip*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Using %s device Abort Bytes transferred = %ld (%lx hex) %lxfilesize%lXfileaddrLoad address: 0x%lx Loading: *octettimeoutFile too largeFile has bad magic%02lX%02lX%02lX%02lX.img*** Warning: no boot file name; using '%s' TFTP from server ; our IP address is ; sending through gateway Filename '%s'. Size is 0x%x Bytes = Retry count exceeded; starting again T %lu MB received TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Starting again *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d BOOTP broadcast %d DHCP client bound to address autoloadNFSDHCP: INVALID STATE RARP broadcast %d unknownethactNo ethernet found. ethprime, [PRIME]eth%daddr Warning: %s MAC addresses don't match: Address in SROM is %02X:%02X:%02X:%02X:%02X:%02X Address in environment is %02X:%02X:%02X:%02X:%02X:%02X Timeout /nfsroot/%02lX%02lX%02lX%02lX.imgFile transfer via NFS from server Filename '%s/%s'. Load address: 0x%lx Loading: **** ERROR: Cannot mount *** ERROR: Cannot umount *** ERROR: File lookup fail /*** ERROR: Symlink fail Error getting the date/time Error setting the date/time Blackfin EMACEthernet: rx dma overrun Ethernet: rx error Ethernet: bad frame Ethernet: bad packet size: %d Ethernet: tx DMA error Ethernet: tx time out Ethernet: tx error Link is down, please check your network connection %d erase regions found, only %d used Flash %s timeout at address %lx data %lx Flash %s error at address %lx Command Sequence Error. Block Erase Error. Locking Error Block locked. Vpp Low Error. protectunprotectwritemissing or unknown FLASH type CFI conformant FLASH (%d x %d) Size: %ld MB in %d Sectors Erase timeout %ld ms, write timeout %ld ms, buffer write timeout %ld ms, buffer size %d Sector Start Addresses: (RO) %08lX%sCan't erase unknown flash type - aborted - no sectors to erase - Warning: %d protected sectors will not be erased! erase done unlock## Unknown FLASH on Bank %d - Size = 0x%08lx = %ld MB yesncncip## Command too long! ** Too many args (max. %d) ** Unknown command '%s' - try 'help' Usage: %s 'bootd' recursion detected ## Error: "%s" not defined %.*sbfin> verifyBad magic number Bad header crc Bad data crc Bad image type Empty Script ## Executing script at %08lx autoscrautoscr - run script from memory [addr] - run script starting at addr - A valid autoscr header must be present %-12s= 0x%08lX U-Boot = %s CPU = %s Board = %s VCO = %lu MHz CCLK = %lu MHz SCLK = %lu MHz boot_paramsmemstartmemsizeflashstartflashsizeflashoffsetethaddr =%c%02X ip_addr = baudrate = %d bps bdinfobdinfo - print Board Info structure ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gogo - start application at address 'addr' addr [arg ...] - start application at address 'addr' passing 'arg' as arguments resetreset - Perform RESET of the CPU ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... %x Warning: src and dst regions overlap ... Error: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d Image Name: %.*s Created: %4d-%02d-%02d %2d:%02d:%02d UTC Image Type: RTEMSUnknown OSInvalid OSNetBSDLinuxVxWorksQNXU-BootNios-IIUnknown ArchitectureInvalid CPUAlphaARMAVR32Intel x86IA64MIPSMIPS 64 BitPowerPCIBM S390SuperHSPARCSPARC 64 BitM68KMicroblazeBlackfinNiosFlat Device TreeUnknown ImageInvalid ImageStandalone ProgramKernel ImageRAMDisk ImageMulti-File ImageFirmwareScriptbzip2 compresseduncompressedgzip compressed%s %s %s (%s) Data Size: %d Bytes = Load Address: %08x Entry Point: %08x Contents: Image %d: %8ld Bytes = unknown compressionImage at %08lX: Verifying Checksum ... Bad Data CRC OK ## Checking Image at %08lx ... Bad Magic Number Bad Header Checksum bootcmd## Booting image at %08lx ... Bad Magic Number Bad Header Checksum Bad Data CRC Unsupported Architecture 0x%x Standalone ApplicationWrong Image Type for %s command XIP %s ... Uncompressing %s ... GUNZIP ERROR - must RESET board to recover Unimplemented compression type %d autostartCan't boot image type %d bootargsbootmbootm - boot application image from memory [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image boot - boot default, i.e., run 'bootcmd' bootdbootd - boot default, i.e., run 'bootcmd' iminfoiminfo - print header information for application image addr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums) imlsimls - list all images found in flash - Prints information about all images found at sector boundaries in flash. offONOFFData (writethrough) Cache is %s Instruction Cache is %s icacheicache - enable or disable instruction cache [on, off] - enable or disable instruction cache dcachedcache - enable or disable data cache [on, off] - enable or disable data (writethrough) cache List of available devices: %-8s %08x %c%c%c %s coninfoconinfo - print console devices and information Reset RTC... ## Bad date format unknown Date: %4d-%02d-%02d (%sday) Time: %2d:%02d:%02d SunMonTuesWednesThursFriSaturdatedate - get/set/reset date & time [MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTC read EEPROM @0x%lX %s: addr %08lx off %04lx count %ld ... done eepromeeprom - EEPROM sub-system read addr off cnt eeprom write addr off cnt - read/write `cnt' bytes at EEPROM offset `off' ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ClearLoad%sing %s @ 0x%08Xvﾭlx (%ld bytes) sh_addr: %08X, p_paddr: %08X Loading from: %08X to %08X, size: %d No load address provided tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddrNo bootargs defined ## Not an ELF image, assuming binary ## Using bootline (@ 0x%lx): %s ## Starting vxWorks at 0x%08lx ... ## vxWorks terminated ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx bootelfbootelf - Boot from an ELF image in memory [address] - load address of ELF image. bootvxbootvx - Boot vxWorks from an ELF image [address] - load address of vxWorks ELF image. %sProtected %d sectors Error: start and/or end address not on sector boundary Error: end address not on sector boundary Error: end sector precedes start sector Error: start address not on sector boundary Error: cannot span across banks when they are mapped in reverse order Un-Error: end address (0x%08lx) not in flash! all%sProtect Flash Bank # %ld Bad sector specification %sProtect Flash Sectors %d-%d in Bank # %d bankOnly FLASH Banks # 1 ... # %d supported Bad address format Erased %d sectors Erase Flash Bank # %ld Erase Flash Sectors %d-%d in Bank # %d Bank # %ld: flinfoflinfo - print FLASH memory information - print information for all FLASH memory banks flinfo N - print information for FLASH memory bank # N erase - erase FLASH memory start end - erase FLASH from addr 'start' to addr 'end' erase start +len - erase FLASH from addr 'start' to the end of sect w/addr 'start'+'len'-1 erase N:SF[-SL] - erase sectors SF-SL in FLASH bank # N erase bank N - erase FLASH bank # N erase all - erase all FLASH banks protect - enable or disable FLASH write protection on start end - protect FLASH from addr 'start' to addr 'end' protect on start +len - protect FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 protect on N:SF[-SL] - protect sectors SF-SL in FLASH bank # N protect on bank N - protect FLASH bank # N protect on all - protect all FLASH banks protect off start end - make FLASH from addr 'start' to addr 'end' writable protect off start +len - make FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 wrtable protect off N:SF[-SL] - make sectors SF-SL writable in FLASH bank # N protect off bank N - make FLASH bank # N writable protect off all - make all FLASH banks writable Error reading the chip. Valid chip addresses: %02X%04x: %02x .%cCRC32 for %08lx ... %08lx ==> Error reading the chip, Error writing the chip. %08lx: Error reading the chip, %02lx %04lx %08lx ? imdimd - i2c memory display chip address[.0, .1, .2] [# of objects] - i2c memory display immimm - i2c memory modify (auto-incrementing) chip address[.0, .1, .2] - memory modify, auto increment address inminm - memory modify (constant address) chip address[.0, .1, .2] - memory modify, read and keep address imwimw - memory write (fill) chip address[.0, .1, .2] value [count] - memory write (fill) icrc32icrc32 - checksum calculation chip address[.0, .1, .2] count - compute CRC32 checksum iprobeiprobe - probe to discover valid I2C chip addresses -discover valid I2C chip addresses iloopiloop - infinite loop on address range chip address[.0, .1, .2] [# of objects] - loop, reading a set of addresses Unknown operator '%s' Invalid data width specifier -lt<-gt>-eq==-ne!=<>-ge>=-le<=itestitest - return true/false on integer compare [.b, .w, .l, .s] [*]value1 [*]value2 nandnorinvalid partition number %d for device %s%d (%s) incorrect device type in %s incorrect device number in %s out of memory single partnor0staticno such FLASH device: %s%d (valid range 0 ... %d support for NAND devices not present incorrect device: %s%d CRAMFSJFFS2### filesystem type is %s uImage### %s loading '%s' to 0x%lx ### %s load complete: %d bytes loaded to 0x%lx ### %s LOAD ERROR<%x> for %s! fsloadfsload - load binary file from a filesystem image [ off ] [ filename ] - load binary file from flash bank with offset 'off' lsls - list files in a directory (default /) [ directory ] - list files in a directory. fsinfofsinfo - print information about filesystems - print information about filesystems ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Total Size = 0x%08x = %d Bytes %X## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ESC ... loads_echo## Ready for S-Record download ... ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes ## S-Record download aborted loadsloads - load S-Record file over serial line [ off ] - load S-Record file over serial line with offset 'off' loadbloadb - load binary file over serial line (kermit mode) [ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud' loady - load binary file over serial line (ymodem mode) Reading... Mem error @ 0x%08X: found %08lX, expected %08lX Base Address: 0x%08lx CRC32 for %08lx ... %08lx ==> %08lx Pattern %08lX Writing...%12sCan't modify L1 instruction in place. Use cp instead. %08x %04xZero length ??? Copy to Flash... Comparison with L1 instruction memory not supported. word at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) halfwordbyteTotal of %ld %s%s were the same mdmd - memory display [.b, .w, .l] address [# of objects] - memory display mmmm - memory modify (auto-incrementing) [.b, .w, .l] address - memory modify, auto increment address nmnm - memory modify (constant address) [.b, .w, .l] address - memory modify, read and keep address mwmw - memory write (fill) [.b, .w, .l] address value [count] - write memory cpcp - memory copy [.b, .w, .l] source target count - copy memory cmpcmp - memory compare [.b, .w, .l] addr1 addr2 count - compare memory crc32crc32 - checksum calculation address count [addr] - compute CRC32 checksum [save at addr] basebase - print or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off' looploop - infinite loop on address range [.b, .w, .l] address number_of_objects - loop on a set of addresses mtestmtest - simple RAM test [start [end [pattern]]] - simple RAM read/write test sleepsleep - delay execution for some time N - delay execution for N seconds (N is _decimal_ !!!) ping failed; host %s is not alive host %s is alive hostnamerootpathdnsipdomainAutomatic boot of image at addr 0x%08lX ... bootpbootp - boot image via network using BootP/TFTP protocol [loadAddress] [bootfilename] tftpboottftpboot- boot image via network using TFTP protocol rarpbootrarpboot- boot image via network using RARP/TFTP protocol dhcpdhcp - invoke DHCP client to obtain IP/boot params nfsnfs - boot image via network using NFS protocol [loadAddress] [host ip addr:bootfilename] pingping - send ICMP ECHO_REQUEST to network host pingAddress Saving Environment to %s... ## Error: illegal character '=' in variable name "%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported eth## Error: environment overflow, "%s" deleted setenv ** Abort Environment size: %d/%d bytes printenvprintenv- print environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name' setenv - set environment variables name value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name' saveenvsaveenv - save environment variables to persistent storage runrun - run commands in an environment variable var [...] - run the commands in the environment variable(s) 'var' --forceError: 'half' can only be '0' or '1' upperlowerWriting one time programmable memory source address: 0x%p OTP destination: %s page 0x%03X - %s page 0x%03X number to write: %ld halfpages type "YES" (no quotes) to confirm: Aborting OTP memory %s: addr 0x%08lx page 0x%03X count %ld ... Wsingle bad bit in ECCunknown errorno errorOTP fuse write errorOTP fuse read errorinvalid OTP addressmultiple bad bits detectederror in ECC bitsspace already writtensingle bad bit in half page ERROR at page 0x%03X (%s-halfpage): 0x%03X: %s YES otpotp - One-Time-Programmable sub-system read [count] [half] otp write [--force] [count] [half] - read/write 'count' half-pages starting at page 'page' (offset 'half') %s ... - No help available. Unknown command '%s' - try 'help' without arguments for list of all known commands versionversion - print monitor version echoecho - echo args to console [args..] - echo args to console; \c suppresses newline helphelp - print online help [command ...] - show help information (for 'command') 'help' prints online help for the monitor commands. Without arguments, it prints a short usage message for all commands. To get detailed help information for specific commands you can type 'help' with one or more command names as arguments. ?? - alias for 'help' In: No input devices available! Out: No output devices available! Err: No error devices available! Cannot initialize the list of devices! serial*** Warning - bad CRC, using default environment Erasing Flash...Writing to Flash... FlashTimeout writing to Flash Flash not Erased Can't write to protected Flash sectors Outside available Flash Start and/or end address not on sector boundary Unknown Vendor of Flash Unknown Type of Flash General Flash Programming Error %s[%d] FIXME: rc=%d flash.cBlock sequence errorUnknown errorCan't access fileSorry, zModem not available yetTimed outEnd of fileCancelledInvalid framingCRC/checksum errorCRCCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries %2ld.%ld %cB%s0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzfile errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkinvalid block typeinvalid stored block lengthstoo many length or distance symbolsoversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeinvalid bit length repeatoversubscribed literal/length treeincomplete literal/length treeinvalid distance codeinvalid literal/length codeincorrect data check0.95Pstream endWarning: Generating 'random' MAC address Jan 22 2008Board: ADI BF527 EZ-Kit board Support: http://blackfin.uclinux.org/ Warning: unhandled manufacturer continuation byte! Unknown SPI device: 0x%02X 0x%02X 0x%02X Invalid sector! Malloc for sector failed! Read sector failed! Erase sector failed! SPI Program Time out! Write sector failed! SPI Device: %s 0x%02X (%s) 0x%02X 0x%02X Parameters: num sectors = %i, sector size = %i, write size = %i Flash Size: %i mbit (%i mbyte) Status: 0x%02X SpansionSTAtmelWinbondS25LF016S25LF032S25FL064S25LF0128m25p05m25p10m25p20m25p40m25p16m25p32m25p64m25p128AT45DB011xAT45DB021xAT45DB041xAT45DB081xAT45DB161xAT45DB321xAT45DB642xW25X10W25X20W25X40W25X80W25P80W25P16Starting Kernel at = %x cramfs: wrong magic cramfs: unsupported filesystem features cramfs: root is not a directory cramfs: empty filesystemcramfs: bad root offset %lu size: 0x%x (%u) flags: FSID version 2 sorted dirs holes shifted root offset fsid: crc: 0x%x edition: 0x%x name: %16s %*.*s: unsupported file type (%x) can't find corresponding entry %s %8d %*.*s -> %*.*s [Error reading link] get_node_mem: unknown device type, using raw offset! get_fl_mem: unknown device type, using raw offset! add_node: malloc failed add_node failed! ** ERROR ** %s %08x has dup version =find_inode failed for name=UNKOWN COMPRESSION METHOD = Scanning JFFS2 FS: %c . OOPS Cleanmarker has bad size %d != %d OOPS Padding has bad size %d < %d Unknown node type: %x len %d offset 0x%x  done. %s: Failed to scan JFFSv2 file structure Compression: %s frag count: %d compressed sum: %d uncompressed sum: %d load: Failed to find inode has dup version (resolve) = load: Failed to resolve inode structure load: Failed to read inode %.3s %.3s %.2d %.2d:%.2d:%.2d %d %s %8ld %s %s -> ls: Failed to scan jffs2 file structure NONEZERORTIMERUBINMIPSCOPYDYNRUBINZLIBxwr}}}}}}}048<@DHLPTX\`@  $$,,44<<DDLLTT\\ddlltt||ķķ̷̷ԷԷܷܷ  $$,,44<<DDLLTT\\ddlltt||ĸĸ̸̸ԸԸܸܸ  $$,,44<<DDLLTT\\ddlltt||ĹĹ̹̹ԹԹܹܹ  $$,,44<<DDLLTT\\ddlltt||ĺĺ̺̺ԺԺܺܺbootargs=root=/dev/mtdblock0 rw earlyprintk=serial,uart1,57600 console=tty0 console=ttyBF0,57600bootcmd=run rambootbaudrate=57600loads_echo=1ipaddr=192.168.0.15serverip=192.168.0.2autoload=norootpath=/romfsgatewayip=192.168.0.1netmask=255.255.255.0hostname=1loadaddr=0x1000000ubootfile=u-boot.ldrupdate=tftp $(loadaddr) $(ubootfile);protect off 0x20000000 0x2003FFFF;erase 0x20000000 0x2003FFFF;cp.b $(loadaddr) 0x20000000 $(filesize)addip=set bootargs $(bootargs) ip=$(ipaddr):$(serverip):$(gatewayip):$(netmask):$(hostname):eth0:offramargs=set bootargs root=/dev/mtdblock0 rw earlyprintk=serial,uart1,57600 console=tty0 console=ttyBF0,57600ramboot=tftp $(loadaddr) uImage;run ramargs;run addip;bootmnfsargs=set bootargs root=/dev/nfs rw nfsroot=$(serverip):$(rootpath),tcp,nfsvers=3nfsboot=tftp $(loadaddr) vmImage;run nfsargs;run addip;bootmflashboot=bootm 0x20100000@ (((((AAAAAABBBBBB ,8L #+3;CScs !1Aa  0@` 0 < $ @4H8P \@ht@        @  @ ̯د$,4 <  0 0@$0,04 <   03fa0000 _start03fa00b4 _get_pc03fa00c0 _icache_disable03fa00e0 _icache_status03fa00f4 _dcache_status03fa0108 _exception_init03fa0120 _cpu_init_f03fa0198 _icache_enable03fa01b4 _dcache_disable03fa01d4 _dcache_enable03fa01f4 _irq_init03fa027c _get_tbclk03fa0288 _enable_interrupts03fa02a8 _disable_interrupts03fa02b8 _udelay03fa02f0 _timer_init03fa0330 _get_timer03fa0390 _get_ticks03fa03a4 _reset_timer03fa03b4 _trap03fa0464 _evt_default03fa0518 _decode_address03fa05c8 _dump_bfin_trace_buffer03fa0670 _dump03fa0938 _bfin_panic03fa0974 _trap_c03fa0b18 _do_reset03fa0b38 _bfin_reset_or_hang03fa0b40 _memset03fa0ba0 _get_vco03fa0bcc _get_cclk03fa0c28 _get_sclk03fa0c64 _sbrk03fa0c98 _icplb_add.273403fa0cac _dcplb_add.273803fa0cc0 _init_cplbtables03fa0e04 _hang03fa0e18 _board_init_r03fa101c _board_init_f03fa1188 _strcpy03fa119c _strncpy03fa11bc _strcmp03fa11d8 _strncmp03fa1200 _dma_memcpy03fa12a4 _memcpy03fa12fc _do_bootldr03fa1378 _show_cplb_table03fa13ec _do_cplbinfo03fa1454 _memcpy_ASM03fa14cc ___fswab1603fa14d8 ___fswab3203fa14fc _startAgainTimeout03fa150c _startAgainHandler03fa1518 _NetSetHandler03fa1528 _NetCksum03fa154c _NetCksumOk03fa1568 _copy_filename03fa1598 _string_to_VLAN03fa15d4 _getenv_VLAN03fa15e8 _string_to_ip03fa163c _getenv_IPaddr03fa164c _NetEthHdrSize03fa1684 _VLAN_to_string03fa16d4 _ip_to_string03fa1710 _print_IPaddr03fa1730 _NetSetEther03fa17d0 _NetCopyIP03fa17d8 _NetSetIP03fa188c _NetWriteIP03fa18a4 _NetReadIP03fa18bc _PingHandler03fa18e8 _NetSendPacket03fa18ec _ArpRequest03fa19f0 _NetReceive03fa1e30 _PingSend03fa1f60 _NetSetTimeout03fa1f98 _NetSendUDPPacket03fa20b0 _PingTimeout03fa20cc _NetStartAgain03fa218c _ArpTimeoutCheck03fa2200 _NetLoop03fa267c ___fswab1603fa2688 _TftpSend03fa27c8 _TftpStart03fa29c0 _TftpTimeout03fa2a10 _TftpHandler03fa2c5c ___fswab1603fa2c68 ___fswab3203fa2c8c _truncate_sz03fa2cb8 _NetCopyLong03fa2cc0 _NetCopyIP03fa2cc8 _DhcpOptionsProcess03fa2e6c _NetWriteIP03fa2e84 _NetReadLong03fa2e9c _DhcpExtended03fa300c _BootpRequest03fa3198 _DhcpRequest03fa319c _BootpCopyNetParams03fa3238 _DhcpHandler03fa34f0 _BootpTimeout03fa3530 _RarpRequest03fa3610 _RarpHandler03fa3664 _RarpTimeout03fa36a4 _eth_get_dev03fa36b4 _eth_get_dev_index03fa36e8 _eth_halt03fa3710 _eth_send03fa3730 _eth_rx03fa3748 _eth_get_name03fa3760 _eth_get_dev_by_name03fa37a4 _eth_set_current03fa3814 _eth_try_another03fa3890 _eth_init03fa38e0 _eth_register03fa3958 _eth_set_enetaddr03fa39d8 _eth_initialize03fa3be4 ___fswab3203fa3c08 _NfsTimeout03fa3c2c _basename03fa3c5c _dirname03fa3c7c _rpc_lookup_reply03fa3cf8 _rpc_add_credentials03fa3da4 _rpc_req03fa3e8c _rpc_lookup_req03fa3ed4 _NfsSend03fa40d0 _NfsStart03fa4304 _NfsHandler03fa4724 _rtc_reset03fa4730 _wait_for_complete03fa4758 _rtc_init03fa4768 _rtc_get03fa47d0 _rtc_set03fa48c8 _GregorianDay03fa49c0 _to_tm03fa4ac8 _mktime03fa4b54 _bfin_EMAC_halt03fa4b78 _RdPHYReg03fa4bc4 _bfin_EMAC_initialize03fa4c30 _bfin_EMAC_recv03fa4cf4 _bfin_EMAC_send03fa4df8 _bfin_EMAC_init03fa50dc _flash_make_addr03fa50f0 _flash_read_uchar03fa5104 _flash_read_ushort03fa5124 _flash_read_long03fa5164 _flash_add_byte03fa51d0 _flash_make_cmd03fa520c _flash_write_cmd03fa5288 _flash_unlock_seq03fa52d4 _flash_isequal03fa5358 _flash_isset03fa53ec _flash_get_size03fa5710 _flash_full_status_check03fa5918 _flash_real_protect03fa59d4 _flash_write_cfiword03fa5b20 _write_buff03fa5c58 _flash_print_info03fa5d54 _flash_erase03fa5ea4 _flash_init03fa5fb0 _flash_read_user_serial03fa6004 _flash_read_factory_serial03fa6058 _nc_wait_arp_handler03fa6068 _nc_handler03fa6084 _nc_timeout03fa6094 _drv_nc_init03fa6108 _nc_tstc03fa6170 _nc_getc03fa61ec _nc_input_packet03fa6280 _nc_send_packet03fa6380 _nc_puts03fa63bc _nc_putc03fa63f0 _nc_start03fa64c4 _NcStart03fa6580 _run_command03fa6884 _do_run03fa68e8 _cread_add_char03fa6998 _cread_add_str03fa69e0 _readline03fa6f34 _main_loop03fa6fa4 ___fswab3203fa6fc8 _autoscript03fa7124 _do_autoscript03fa715c _print_num03fa7170 _do_bdinfo03fa72d4 _do_go03fa735c ___fswab3203fa7380 _gunzip03fa74b4 _zfree03fa74bc _zalloc03fa74c8 _print_image_hdr03fa77bc _do_imls03fa78a4 _image_info03fa796c _do_iminfo03fa79c4 _do_bootd03fa79e8 _do_bootm03fa7e88 _on_off03fa7ec4 _do_dcache03fa7f2c _do_icache03fa7f94 _do_coninfo03fa804c _cnvrt203fa8088 _mk_date03fa81dc _do_date03fa82b0 _eeprom_init03fa82c8 _eeprom_write03fa8318 _eeprom_read03fa8368 _do_eeprom03fa845c _valid_elf_image03fa849c _load_elf_image03fa85c0 _do_bootvx03fa86fc _do_bootelf03fa87b8 _flash_fill_sect_ranges03fa88bc _flash_sect_protect03fa8984 _addr_spec03fa8a64 _abbrev_spec03fa8b3c _do_protect03fa8d9c _flash_sect_erase03fa8e0c _do_flerase03fa8f38 _do_flinfo03fa8f84 ___fswab3203fa8fa8 _do_i2c_loop03fa9070 _do_i2c_probe03fa90b8 _do_i2c_md03fa9250 _do_i2c_crc03fa933c _do_i2c_mw03fa9410 _mod_i2c_mem03fa95a4 _do_i2c_nm03fa95c0 _do_i2c_mm03fa95dc _evalstr03fa95f8 _evalexp03fa9640 _binary_test03fa9758 _do_itest03fa97cc _jffs2_part_info03fa9830 _id_parse03fa98e0 _mtdparts_init03fa9a20 _do_jffs2_fsinfo03fa9a90 _do_jffs2_ls03fa9af0 _do_jffs2_fsload03fa9c0c _ktrans03fa9c38 _chk103fa9c58 _bin_data_init03fa9c84 _bin_data_char03fa9cb4 _k_data_init03fa9ccc _k_data_save03fa9d20 _k_data_restore03fa9d74 _k_data_char03fa9dd0 _send_pad03fa9e00 _s1_sendpacket03fa9e24 _handle_send_packet03fa9fd8 _send_nack03faa034 _send_ack03faa090 _getcxmodem03faa0ac _do_load_serial_bin03faa654 _do_load_serial03faa8a4 _do_mem_base03faa8e0 _do_mem_crc03faa964 _do_mem_mtest03faaa34 _cmd_get_data_size03faaa98 _mod_mem03faac0c _do_mem_nm03faac28 _do_mem_mm03faac44 _do_mem_loop03faacf0 _do_mem_cp03faae34 _do_mem_cmp03faafcc _do_mem_mw03fab070 _do_mem_md03fab26c _do_sleep03fab2d8 _do_ping03fab344 _netboot_common03fab57c _do_nfs03fab584 _do_dhcp03fab58c _do_rarpb03fab594 _do_tftpb03fab59c _do_bootp03fab5a4 _envmatch03fab5fc _getenv_r03fab694 _do_saveenv03fab6c0 _getenv03fab728 __do_setenv03fabad0 _do_setenv03fabb00 _setenv03fabb28 _do_printenv03fabc74 _do_otp03fabf80 _do_echo03fabfe8 _do_version03fac008 _var_complete03fac060 _find_cmd03fac0cc _cmd_auto_complete03fac46c _install_auto_complete_handler03fac488 _install_auto_complete03fac4c8 _do_help03fac5fc _console_setfile03fac668 _fgetc03fac684 _ftstc03fac6a0 _fputc03fac6bc _fputs03fac6d8 _disable_ctrlc03fac6e8 _had_ctrlc03fac6f8 _clear_ctrlc03fac708 _dbg03fac714 _console_init_f03fac720 _console_assign03fac794 _fprintf03fac7dc _puts03fac7f0 _vprintf03fac824 _printf03fac868 _console_init_r03fac9c0 _serial_printf03faca04 _putc03faca18 _tstc03faca28 _getc03faca38 _ctrlc03faca78 _devices_done03faca94 _device_register03facab4 _devices_init03facb6c _malloc_bin_reloc03facb94 _malloc_usable_size03facbc4 _mallopt03facc10 _malloc_trim03faccb0 _free03face60 _cfree03face64 _malloc03fad2dc _memalign03fad3b4 _pvalloc03fad3c8 _valloc03fad3d4 _calloc03fad470 _realloc03fad760 _env_get_char_memory03fad77c _env_get_addr03fad794 _env_get_char_init03fad7c0 _env_complete03fad8ac _env_crc_update03fad8d4 _env_relocate03fad954 _env_get_char_spec03fad960 _env_relocate_spec03fad978 _saveenv03fada14 _env_init03fada60 _dummy03fada6c _get_version03fada78 _jumptable_init03fadb18 _addr2info03fadb44 _flash_perror03fadc08 _flash_write03fadce0 _flash_protect03fadd74 _GetHandleSize03fadd80 _ListSetAllocationPolicy03fadd8c _ListGetPtrToItem03faddb0 _ListGetDataPtr03faddbc _ListGetItemSize03faddc8 _ListNumItems03faddd4 _ListGetItems03fade04 _SetHandleSize03fade58 _ListInsertItems03fadfac _ListInsertItem03fadfc0 _DisposeHandle03fadfe8 _ListDispose03fadfec _NewHandle03fae030 _ListCreate03fae06c _hex1_bin03fae0b0 _hex2_bin03fae0e8 _srec_decode03fae270 _parse_num03fae360 _xyzModem_error03fae3d0 _xyzModem_stream_close03fae41c _CYGACC_COMM_IF_PUTC03fae424 _CYGACC_COMM_IF_GETC_TIMEOUT03fae468 _xyzModem_flush03fae48c _xyzModem_stream_terminate03fae524 _xyzModem_get_hdr03fae714 _xyzModem_stream_read03fae920 _xyzModem_stream_open03faea60 _cyg_crc1603faea98 _crc3203faeb6c _crc32_no_comp03faec44 _print_size03faece0 _display_options03faed00 _strcat03faed30 _strncat03faed6c _strchr03faed8c _strlen03faedac _strrchr03faede4 _strnlen03faee18 _strspn03faee58 _strpbrk03faee94 _strtok03faef10 _strsep03faef40 _strswab03faef78 _bcopy03faef94 _memscan03faefbc _memchr03faefdc _strstr03faf028 _strdup03faf060 _simple_strtoul03faf144 _simple_strtol03faf16c _skip_atoi03faf1ac _number03faf388 _panic03faf3a4 _vsprintf03faf68c _sprintf03faf6a4 _falloc03faf6c0 _ffree03faf6cc _inflate_trees_free03faf704 _huft_build03fafc48 _inflate_codes_new03fafc84 _inflate_codes_free03fafc94 _inflate_blocks_reset03fafd2c _inflateEnd03fafda4 _inflateReset03fafde8 _inflateSync03fafea0 _inflateInit203faff70 _inflateInit03faff78 _adler3203fb00bc _inflate_flush03fb01a4 _inflateIncomp03fb0270 _inflate03fb1768 _initdram03fb1778 _misc_init_r03fb1784 _board_get_enetaddr03fb182c _checkboard03fb1850 _spi_init_f03fb185c _spi_init_r03fb1868 _address_to_sector03fb1894 _SPI_INIT03fb18d8 _spi_write_read_byte03fb194c _transmit_address03fb1974 _read_flash03fb1a20 _read_status_register03fb1a80 _spi_detect_part03fb1c9c _spi_read03fb1d00 _enable_writing03fb1da8 _wait_for_ready_status03fb1e2c _spi_write03fb2088 _eeprom_info03fb2130 _serial_initialize03fb217c _serial_putc03fb21c8 _serial_tstc03fb21d8 _serial_puts03fb21f8 _serial_set_baud03fb2260 _serial_setbrg03fb2268 _serial_init03fb227c _serial_getc03fb22ac _wait_for_completion03fb2430 _i2c_reset03fb2494 _i2c_init03fb2498 _i2c_transfer03fb25c8 _i2c_write03fb262c _i2c_reg_write03fb2650 _i2c_read03fb26b4 _i2c_reg_read03fb26d8 _i2c_probe03fb2728 _blackfin_icache_flush_range03fb2740 _blackfin_dcache_flush_range03fb2758 _blackfin_dcache_invalidate_range03fb2770 _memcmp03fb27c8 _memmove03fb2838 _do_bootm_linux03fb28d0 _flush_cache03fb2914 _cramfs_check03fb2970 _cramfs_read_super03fb2a84 _cramfs_info03fb2b3c _cramfs_resolve03fb2c28 _cramfs_uncompress03fb2ca8 _cramfs_list_inode03fb2dc8 _cramfs_ls03fb2f00 _cramfs_load03fb2fc4 _cramfs_uncompress_exit03fb2fdc _cramfs_uncompress_init03fb3028 _zfree03fb3030 _zalloc03fb303c _cramfs_uncompress_block03fb3080 _get_fl_mem_nor03fb30ac _mkmodestr03fb31cc _get_node_mem03fb320c _get_fl_mem03fb324c _jffs2_1pass_rescan_needed03fb329c _insert_node03fb3338 _jffs2_1pass_find_inode03fb3470 _jffs2_1pass_search_inode03fb358c _jffs2_1pass_read_inode03fb37a4 _free_nodes03fb37cc _jffs2_free_cache03fb37fc _jffs2_get_list03fb3b80 _jffs2_1pass_info03fb3c9c _jffs2_1pass_load03fb3ed8 _jffs2_1pass_ls03fb4508 _rtime_decompress03fb45cc _rubin_do_decompress03fb4684 _dynrubin_decompress03fb46bc _zlib_decompress03fb46d0 _cramfs_memset03fb46ec _pull_bits03fb4738 _pull_bit03fb4768 _read_symbol03fb47d4 _decompress_huffman03fb48d0 _fill_code_tables03fb495c _init_code_tables03fb4988 _decompress_block03fb4e14 _flush_data_cache03fb4e5c _dcplb_flush03fb4f34 page_prefix_table03fb4f44 .page_prefix_table.end03fb4f44 ___udivsi303fb4f64 ___umodsi303fb4f70 ___umulsi3_highpart03fb4f90 ___smulsi3_highpartffa0000c _bfin_resetffa0000c __stext_l1ffa00030 __etext_l1,b4b\bccDco$qoo`qpqhqqrqrpr xrxyxx|yyyyyzlyzDz{w${P{{,{,|d|~l||}}}܁}~~h$DLx8D0n ԅl<0؊܊@Dxċ8<<\PȌpHt|dXlȐ $P T4| p((l p̯<@X4 PXD$pdxЛl؛М؜4@xȝ@`|4`زh(ğкdLhP(t,Tt|ȥ ,\` $ﾭ$I 8`*K `$/ͭfs