Pԭ ﾭJL  LP $` H(`I ,J  o!B J  `oB 0$@J G `"l0$@0$@J@{  {@"l{ o`bl`Bl0`"l"mJB@!"o@ "l""a"lc tݭ ﾭHPﾭNa>`!6)61696<<1`O"BCZRR`2 J#h LYZb@`eBR@02~200< H IA !J KS L\>{ 1J@ $``gFo~0gdE10b`` 0 00g0b`N B4AR0@@BAR1J ``J @`0J `"l"lJ@  bl"l"l"l"l"l"l"l"l"l"lJ !`0#@J @0#@` J `J @0J `0  ԨJ@`Ơ #APJ11R  IJ 0`` 0c"lo8`#J J `xJg 0I80 C oJ d 0ALJ "@flN'P8R8go`fl`'J` @OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g1@|}~yz@F0ofl&l:9>=<0>'&l&524130#"! &lw&l@OxPQRSTUVW\]^_XYZ[`abcpsqtruf@g1@|}~yz@F0o=fl&l:9>=<0>'&l&524130#"! &lw&l`LgJFo 010 Ȼ`h N0B0d`%r807 p (0 d0pP2'2 lP  L0RA0E00'u!  A0E` OcPA A0E A0F0ul't pKLg)\J[ `0L@0F]J ``T *` L a!^2clC0@DF0S0]!C0t@XFK0]dJ ``T J `)['ts0xK2L@+lFb]X@FX]`pOAT@qMFM]aAT@FD]O7` `@T 9f2lD0@F0T0+]d`'lf2l٠D0@GL0]D0@ GL0]YD0@GL0]١D0@$GL0\D0@0GL0\aT J D0@ DC0pd!`OJ@% ;!TTJ L 8%@MnS8  J 8%J 8%d0aflwS0J 'tBRds8`KJL C2Jh` C )0J U80BJ 7G82B>B  6c2=0BlWg c2=0tlg" ` $0gA0NQ`@ajL A30ҍHN!@@ QBKJ  )`&`J J` J J J  @$Q8Kb J J ]J A (HJ J gJ D{0HOPgdQ0P 0{J  S  '@dQJJ` D% `9Bd@lQ 0J@QJfl'ts fl'ts BHC@OANVHTAOV!O@T@NVV0xgo090 @Q 0J0gl'08"`"` hK2L92*$Zj0 ar 2`70 # ' z``Gb`- a a aaX "B d}W K0@d K0@ds K0@d/@a0QL80 $K0D0d02![ @!@0QrL80 DK0D0d02"[` = K0@dp4 K0@d/@Q!0I80l  @ RIO0 lPK0d0Y2`Zl @IC0dF0`d0 @T%0wJ C@1d2`v lQ0Z @C0";J CP @ KJ0@l'0`KL82 DK!C G0! Ay0g@CHC)`1`4 01`+g0$d0J D!% 2 `[D0ASccD0 dO0G0fFA 32`"LD0PA"D02`[\2l0```SAbM㷉0NBglD0O0@e|0ge'l0O0'lD0O0eD0e`|D0A2`X%eD0 0eF00dK0)PJq `u80 D/P0cD0"C2!OP O0 Q0NASccu70&d2 a)`i 2Zl!] 0-AScc0O0EG0J 0`@|RFJ DP`G@R=2B P!nJ` D%" AB0R x  @RnF J  !`/lw'ts J D!`g o @PJFfl'JA 3fl'pxLJg D d@oRMFJ A05qQ'2 AX%2` @``0` ` 0@d0AD"`pd0AX%d2`2`c d ` lJ T0BRdA 05"fl't@48g@oR<2B P!n J` D%fl'AB0R fl'fl'J D!`g o @PEfl'A 05fl'Hgofl`'HTAOV!O@T@NVV0g@oR^EflJ ` D%'xgo80*XGP 2zaP d g fl'08xgo802`fl'08xg)[80F0`dJ $p ! 0 ᣆJd pJ H` pJ L/c) ['8`KLC~2glA2tG0G0W 080dcU`c2O 0dY`X\2e0R#lX`T#l #l M2^C0O00P0 dM2`S^Q2HJ2!lPHBl) P[wBlB0'ts `LJg 0)d[10"2p``O0050w )*qZZB0L0J DQddN00d0 5 (O"o ᥆JJ H J LJ PJ6 D@)['t pg&nfo`107w00p`O@`V0 5 (O`doml'0pKLJg) X[QoqJ S^RR᥆J ` ᣆJ` J 0^2Vl80C0 20V `T 0 dM2`^00D0U0d 7dM2 `^DB0M᥆J J H8 J  ~0d08RM᥆J!`0 J 0^2_Vl80C0 2Aa0 `T $m 0 dM2`^00D00d 7dM2!`^DB0MᣆJ+ J ^2lJ C0S 2A a0 0``dmDD0MᣆJ1`S0 v0d0180Ae aSMᣆJ)`0t)['ts0xKJL ` @GJ T%D2OK C@8X *J D@CƁJC@CN0q@AR\$ZA8\@@P9B C0a{U 2D C0[2 lL08 8K0L FJ  V @SBJ DL@P DKvB  J  J T%!JTT @PWBJ J @L,S dB H@PYB AHOteTJ D@@SFBA5`h@<^J` TJ` XJ  P@`2`lw'ts8pKLJg P) 2[2 J XQoqJ S^RR᥆JL0`!ᣆL0J!) ZL0C0V0@J "0 0 0 0  J` K0@da,(`!@dS # N0PL00J &0 "0 0 J @`aZ@dQXAJ @ @SLA `J D%^!) ZL0C00J ,0 (0 $0 7  K0@d aJ0` XJ J  !@S[ ) ZL0C00J E0 A0 =0 90  50 g00ya,c2Km AS`SS80PL00Q[2Z`Z L00O2Z`Z @S@ F0L0"d`d;&J c p  0 p  p CS K  )Ad0MR!EQO@@ Qa@Affgf0XMR!@aaA0J 80J DQT0P!dJP0J  A`5s J 8P& 0d8`  J` @ ` L J  `J X 'A`57/) (['ts0 pHJ xIJ J ``xg o80 fl'@T8?J ``OT!`N@aKTP!KTa1N@"N:O@flYP'P08`KL 2gFoD l't@4Ts w?!`c3#s^A.E80灂ƀ 8O@AᢑS0ųفXN2 L K0@AለRቈ2ǁ00.N6 A.EUE0㹁Aᢑ80ų0㱁O`aOMOTOAለWቈC0㢁a@C0SaUW}W%l'ts `KL2g&nF0A`dTTa_`T'0 g%AQ0ㅁ(M 0R!d@AQ0u8M0R!@ K 2 h40AQ 0d4\iqZ (M(R^MSAQQ0'mF@8M(RQؠQQD0QAI0$60Pm'MRtARSs hLg!2A.¦oE000PMHSA.0E 8O@AᢑS0ųQ_MSAᢑ0ų @AለS0ቈQ/MSAለg0ቈ݀a@"S&  ES d`BT 'n#m bJ` PJ `  ES dJ` d Pfl!'D0t(`10gg o(0"0fdgAQ0　(NAQS0u8NQ o@A᪪0᫪i!m@NPQQ`@aQ@0Q@A᱆pဿPflQ'0 22@^ѠP2@2ҬZ22@^2ҬZ2BZ AOV2x2@^2ҬZ2POPZ2 V8BZ 2OZAOVV2 2h 0  ) "`B`"  PC@OAV    NJC`Ɗǁ†Vƃ`VYVI(24 2KL` gT A0 `!22 dZPCR tsL 22gFo,@^ҠPV0pbdD0   !`A` r  r r r1Q0$@l'tpL 2go'U"  D010 " UD00l't0KL 22gfo@^ѠPV02,D0bdl   !`A`` X@C  XB  Z`0l't0sKL 22gfo@^ѠPV02,D0bd*   !`A`h Y HTIC YHTB T2 Y3TYTh2l'tB0s` 0 4@AK DLP 82`x``H G0``' `G0"U Q`G0`E * R`G0`;  Y`G0`1 `BaG0Bx`G0`;xB 7!`3 OPC  B`@C /`G0`B(d@2@`ZTx @T"`;m x00~ECx  (`a@2`ja`hZP#r0C *``G0rB ! AO1@*ƀqZd[Z` x  `G0` ` 0p d lQ0d l#lqd!dq#8a@2Ra` hZ@=G0BK0@a@2yC0$`Z@0(a@2Z@.29HC0AbMZ@80 a@2 [ @0}00Ab6N0M}0@)R2kQ>JZC0@80a@2AbM`HZ@0a}006N@Ab0MW}`'OkxQ >I  N.`G0`Fm8w'ts `KL922`24(0 01 `rX  PE  C!`JV0^C0!@dԬ1  9 !`A`2 `aTQT@CIC `2aTQTBB 2!TQT &0gq"cUUTT O0C0``X   { O0C0`b q^@ҠT 0E:aO0C0` @T8 O0`C0l;_@T 0(:.O0C0``/aO0C0`k @U9` `O0C0`Z @(U9G``O0C0`J @8U9'`@`O0C0`: @HU9.O0C0`lw0'ts pK2L!2go P:0`C0m `L0C0`e ``C0L0\@HXU `C0L0M@H`UL0C0 00Z X c2  C00 `d l l't0s0hKL 2go22 6w  !`A` YqTpCIC YqTBB 00T Y0TyT0q9o  j(0`  *  !`$ P`D0` @`D0` D0` "U  `D0   !` A`     _ ١g2T^alʐ g/@lU"Ipl'D0ts(l't`s(`K2L692CBU*S W%2``0 N0"C0d d N0:C0dg ld    N0"C0dd0q0 0C0 Ol0 ``0 N0:C0dd0q0 0C0 4EQS  `( %2``0 N0:C0dd l 7 N0"C0dd0q0 0C0lw'ts xKL 2 `O lw@tU'ts87@OOU 8!@NU8 J!H"I`0@U7@0V7|2gl\2`, Affgf0PzMRAP@LV7 B@TV\V@9dV7d llwP`'ts88hKL 210 `Ogo*0@pV  @Vp7` 2*>00`ZZ  0d d*  @Vy7 P`e8 P2`ZW  R`  8  !`2 P0D0`a0D0`  D002 "U  0D0D00a0D0`@V"HD00Q ` pa 8d l/ @V6l't0s(pLg@oV.L D80``O00  Ʀ@W`066  4A0 0g "  o  + kY 8C;aC"\ Z #aC"\ `V ?oS 8CCaM!{Io aC 8B?o? 8CJa#};D0PRgh V2lZR0BZH 2l@0N2lZ`A0$2B  9 loQC C  8C9aC"\?o` ` `0 C t C `8(`*0ZPZh lHaJ` XD$,ZZQ l lH a J`/(Z^ zh`S @$_`B- ,ZZC 0T) 2D @1D_+-c. bS @!h_/J ,xQ  H@t_,/ J(Z 0S0D0a c(c, p8Tp4aC  u ` c)`[w0'ts hLg o2)020 2`$l @h_ @_!,` #  0[8 $ld7`fl't(hLgo "206r(0!4g fl't8`(-0 d $ SFP00dg[2b@_0Z"P|, d  @`e-g  2b@_ `Z"Pd, d fl't(`KL 2:2390456 `O0S05vg? lw'ts hKLJg  fn24J J J @cJ IH Pd`A P 2*QZJ dZPJ` C0+`0 ``,00S`Ck`P`,I O`ZIC  "6" C ![`/F0eg0@Op F0d `# P@C8 2J _^RRF0dxP2N0edg1AOq!008/r`CI`  B  : T8 ) +`V1`:C` ` s` Y`k ` ` `!z ``b/@`>,0g00 W/J` Oc!1Y0 JJ OZP",0d"!0 <@`,0g!0 2AR10g !2GOxP00 dFZ2@P_0 +a+`@`+dD0k 1 90 a+d  @`+01 g, 0 BOARP K.@`+0g00  ` a+d  @`+01 g.1 GSOg1yP00 dY@`+2@_P0*a+@`g+> g C`H@ ~0g8 J J ARQ%i I @ bJ PX0ZJ d `IAFt J d^ > @`2+0g00  ` a$+d  @`+01 gGO000<2 'PRP@_*0.1 8`*.GOyP2`C0<Pp0F0 eV00C0Be?& -0ARP0qP-N0aeAOC1V0!qe 0-C a*L bI dA^O d` ` J ! J dJ J @C0m'ts(xgo'`@_L @AO$` 8 @_G) `@$80 J` $/ `/HTAOV!O@T@NVV0hLg00@o_K 2B  ` P!n``)(L d"@0D0VX B'V@_ `80``L0"@K:8 @`(`d @Q 00`4:80@`/J d1`@(`/&2 80@8`/d+ 00/`& L000W~P2&2`0 R``T0 R 0`B L0 d l` `0*fl't0(xgo 2`O P``<80@H`0(fl'0880@0` 0q(xKLl@`hb(@a[(@!aT(AC`jp@0aE(ACޠjp@Ha6(ACjp@`a'(@!xa@aa@a@a@!a@aa@a'  @a:a'd(` /2Z@{0aaKl'd[/@a'`@a!'flw`'ts8pLgo 2:0 @ h_'`, P``r0; 2@,b&dL0'M ;Q eg00d 0``:8@Tb'fl't00HTAOV!O@T@NVV0hKL 00)0278P 8S0BP P @c&'B`JC T @c' HTh AO`dP 2HZ l"HZ lD0 HdL08 @d&c8 @$s@s~00gd`c0FB 0@8d 8T0RZ0!`0򼶱D0@\d&/0R80hA`m&lw'ts(0)@czdT)pL 2g&noC80T0@e|da&N00d簢p00p𡰱@1d&@dr&` 2J Dl^RRBd# Bd Bd Bd Be B e Be Be` 2J l^RRA eZ A(eU A@eP ALeK ATeF AXeA A`e< Ale7 Ate2 A|e- Ae( Ae# Ae Ae Ae Ae Ae Ae AeC` 2J l^RRCe( Ce# Cf Cf C,f C 0 ,82wa&S#I O: 7H H8O0@AdDnLK3w | -! Ԯbz@Xn!!J | $lblT#lP`" dL x + lw`'ts(2 2J`Q0f@C 0f@CK` CfQ`@CPf` cpKLgFo2qa803 2030D ` T0:RR 03N000dD0 00 \``0N0@dad q0N0Pdd i!d@1 R`0N0@dad^ WAQ0c(MR!d@PX `` B`@!T ;v0d00u 3pa` /0d0i ' ``r 0ڰ dwﾭ0Y p` 7d00M pa XC0` cl'ts0xLg&no 24* PA` c+ @n ~0e07`01 @n3 0[F0e#౯w2q@n J H^P0pp0@n0` @h_`mFl't8goGflP`'cN`L 2gfo10*0Q ƁƆD0AVF0S0d`}QoJQ l't` `L 2gfo10*0Q ƁƆD0AVF0S0d`}QIQ l't` hKLg2(`FoP``3(0``}300`` w3A80p`U 6w@b p`D00` A`lU: ,6w@ p`b)`00a80@Hp  A`PM l'ts(K@h_`l't0s(2ALFEgo@p  ` @qJ0`fl'`KL82Aapx 2:ZZP ` Zb0``c :2Z [HZ Wc T `A`A@4q 0 2@rL0? S/ @Hi 0` cO"\J` cOd 0``:8@sSfl't08pKLgo4"23` 4c 0 jJ DaРP80J2gg`al B0 Hg0  0 0#0 d!lJ D ! 0 B @Pt   @|t` ARdAP Р0  @t/ @t/`fl'ts0`go 0F0dg00 0V0dq00p D ,J  xS@00 D `0pad =0d `@Vm A u J D/At@t0u  @tH`m'0 xKL:2!2N0ad`803v08B08TP QD `Ya l` `N0adD0`^00b<P 98C 88IP Dg``al gѠAP Ig   ` d!lJ D9C   @$uc `lw'ts8`KL!0a80. 2D `U v0`fd0%0R`/0B08FP C A ?O D6 lD0iak.2C D00R`/80b$P !C 0 0C0R`/0ZP   2`W clw'ts hKLgn 2:04A`l| A`|hs  ` `APug ?K`h Ds,A@ ut@Tu0D` 0B00q `pa'drD @Vd*4 Z/F0dN0V0!ed% < @puq A@ utCp DpRCM@d0@uh 00p `padp P `kAu L0``. @u `Y A@ ut@Tu `J Dr`h @tUz6 0B00 `padrD *@Va# F0dV0e @ut 1 @h_h h 0 2Fm'D0ts(pgoV0dg2Bd00p  ! @ DSd00@v07 `/ @t`m'00xKLgn 2:04{A`Pu JF0dN0V0`ed % @pu`f C0 DRCM@d@q2,v0q2*  @Au` !0``- @u `. @v `J D2gB0` F0dV0`dF @u/𡱡 @h_/;&m'ts8g o``P- @u `y` @Tv `p@ D>`fl'20RaP d0``x-02xg090PQao  d0``f-2 0``^-0`fl@'gT8`KL:200!0K+80 d001 ^+Y \20(0G0000+800+8 00l0LJ |^RR `@ N> ` ( 8 ` " 0080 0G0l0(J |^RR/` /`   /`` J ĮSCl/@8{0`flw'ts Lg2 `ot @h_`% !`_  0 0  ` a a`K @P{R` l't2gfoA ) B@| @8| 0@D|N ` 2 dA0dhlB0'xKL"2go802`A 8|0"`; `!d  0A@|`+ ` d @x| J ጶ2ZH @|0` N0A0ad`,C `l'ts8KLJ ( ` PO$ 8@|T `"P㘼|@|`\2lT0@ me|s n RC 2A@|@|  @} A@8|@|@@} yJ $`' J DذD2@`m|`[ ycBؠQ2l`IJIPB`lw'tsxgo] -J $` 80"F A@X}`}@h} 0F 0G 0P  `fl'8pg oFS rV J $` 80F 00H 00|Q  `fl'0`KLgK@&o D K204 80@}8 g  ```* 0 \J $`< 00QYF A@`}X})(@} 000BF 0001I 000O 00@ 00}~0dqA0c0-@O0p @} 00X  `l'ts C0 `T#@1L Ta1J C02` P lP `TPaTJ` DJ `eJ XJ PJ D0 I PJJJ `egJ \`J deRRJ \J `J DJ HJ `eJ LJ PJ TJ `J \J HJ DJ LJ `eJ TJ PLLg \! oC 0@J 8eRCb` J 4eP` fl'tflJ' 8eRt0RxJg \eo J iePLg fl'8L 2go l:` fl't`KLJD he4eh`2IO` \eie8aJ 0eA}eg2RkoDB `u B0gL ,&~ !`g 0ga )`^ gg@Ca 1`Q 90g8 @9`B 0Jgg he haA`1 2g a I`% 0g"N Q` 0ga Y` g a` a `K ,`!20ee l YZ`C0z0dI2e l[lJ heP wC0'ts xLL ,eg ` N!`aD0odJe hePfl'D0t8xLL ,eg ` Y!`aD0odJe hePfl'D0t8go fl'flc'`KL@K:04  `O0 ``( r```' "`R`' "s0@1TP{7@Psi`A 㱻 z@2'DV0`#80zPP$ +`` Q0 D000 !"0L00uQ4Qf2^0l'DD0!P" 00 0 !0@F``"DN0P7!A`᠘! 0>@ 00F^0 QA00x*@O0A !@2*J X@Jh de@Jᔔ 8eJh` heJ` \eJ ieJa 4eJ \J `J DJ HJ `eJ LJ PJ Thk@Jje 0e  /C%.T C/T gT0|CIJLHOKBAe ` \ HDL `eTP 2 82 2 82w,CT02T HCyCPqCgwCg7 AQYcC\0T o\CL0T hUCT0T axCqCPP`TPaTeSg _qC@gxCQXCBQ+ 5C0 T ?[0C"D0 #SH0e2J jel ApCEQg  C T `TPaTe Co`82 d0 2J `J \J HJ DJ LJ `eJ T$2J PC0[c0 C0C!S0v 0z"Bn$22.``  Yd#d0ㆺ@00F0!QA00(@O0 L: D ` @<l` @dc#`0q(@ᄀVP r&>PJ`/w7-J PJ XS/)H[w0'ts `KLg)@[ᴀ:0.2B Pa` `J ̮ h 2``P %2@c`` (V0#@F0'<[ZPdPR  S gN" 0K0Q0Y 2 D00 c 0L0>0P> g7" ,, 'sS@d00700㙹#V0QA0O0'@0O 6b "0J ̮  dAQ0R(M R!d@pag(D*0Z[1 pJ ̮80 8CS8C .  * Q`j`V2l` DT2 'j@QM  l(ZN2 l`T2 D =c`) - d d> @L` @d0J D`)D['ts g o ``P$J dJ d@ fl`'`Lgo 2"0t @h_`, ```#J dQ``#0000` (0P@g$0 ``#2`l't `KLgo :0K  ```#2 aO ``# 0 ` ``#00 ` 4@BL0tiS20 (PJ0 @̂7c2>0 ": @؂L0MQ$lD0  C CC/P`.l't`s pgo0090! $Q2qae g  !s!d c c ` ` '`fl'00hKLgo2p )0 @h_ J eTJ eH00 !` 00`X`"J dP 2J IZ J JP Z)J @xe @ᰃL0 `@ḃ!  @! @!ȃ@ЃZ 0  J OPja   C 02 GON0ad0`"08 `!  ! ! 2 [/` J eTJ e`l'ts(gfo0q10`>l'gfo0q10 `0l'xKLgo 2 @h_> !` 807``X/" 2``)" 0  ` / `/`/ ` T2 0 g9 / T2 0 Pg9 /T2 0 Pg9 /fl't`s8`KL2 ` @h_ B !` 00;``X!82L d``$!(0`ؠ`d! 80@ԃ{  22![D0Z @@j C0L00 `G @HpY ? I HZB JP Z(B ZI J !JP Z(B @D0K00ʵ `   X  X 2Z[g? `flw'ts pKL2 ` @h_%  8!` 80 h L`` dx0!!P2``(!00``d!!I HZB JP Z(B 2H"[ZB >JP Z)J 5@ hd !`! !@14K0 B h0  !  @l1< ! 22lZ[ hO0 `Bh hA@ @AO t@O0~ @1ᬄK0t h/lwD0'ts0`KL20ggo2t @h_W  !` 00`0 ```f J d 0``[ !hK80 ` `ࠂ`P 0,Q2 `   2Zg9 `fl'ts `KLJ eTJ e2J ЮR 203 @ h_ H80 !` 80` ` `X`J dP 2``@^2@ᰃlL03 J` I Z ,(J WJP Z)J NF0dL00 ~2l` ` 1@ḃ 1  @ @9ȃ 2Q[ ( ` 1!@ḃ 1  a@B a@9ȃICe 2Q[ {2` @3 h hqZZQ0g@C"^ pa7  @IC$? lC0(P`( @ M,S bJ eTJ ЮJ e&mw'ts pLg:0o 2` 00 @h_! ` c `R`P80 @  d㪫0㫸 `fl't0KLgo 2t`gJ <%  @h_ c (` @Љa ` @a `fl'tspKL 9200@K:03 ``J D   ,3 ZaP@CJ0 B0``J D `X`J D@C"㱴 @9h_[  0㫺 00` J  ~0d0J@N0MJ  ~0d07@N0:J $P @J0,J DP @J0J D ~0d0@J0 J T% ~0d0@N0J  ~0d0@ 0J P @(J0 -L D 0㯲@ i A0/cfl't0 Jg ᄶ@o8 `fl'hgo(0`  %dJ R0b@C 00[ fl'(z70dJ R0b@C >0/fl'`(`KLj`202Z 0Q2a"l2WG0L $2ch @X: \2 l D0`RG0 0c2 l  AG0ᐌグ AG0ᘌy ` AG0᠌n ` @ᨌO0]`H!2 A`KQ 62`R`cJ80` X(`  d(`"l@Ἄ0/@0T&Pܨ4Pը i`HCS0 d2! l D0 o `  P l @C /` 2.0Ed 2 + l b2 lB0 G080d2`ddQL0 R!P @`/ lx C 2` Qa a H l C  d"l`AJ㜯 24` k0N0d`q2P Jd0` lj/AJy /2``2P CH0N0dR`q2@CVP Jd `T@OÄV OT2C@NAVVR1 AKA A K7 2@C"u `/0/2``8J D`lw'ts go 2fl0' 00E@h_fl`'gB&oV00q``bd*l'`KL r`1 2hh$l dJ R0b@C  J R0dbCP` @ hg >0dJ R0b@C 70/@$0"hN $`c/ dJ R0b@C 00 000Rac J R0>0dbCV70P`P =0dJ R0b@C /0/ @_ 0H ll$lrflwC0'ts `KL 4A2l`20.|0 'd` `g'2`L2A!l`p A`lU J r @h_*!I q``0`ࠂ` (0 ` h ``82)` ``` 0 @t/` 3UqJ QNG0QAC0ᜏHᤏgHNP p@1ᬏK0h J ,C0N2AmZP8 lZP @J[@2Jᅔ C%27@ᴐ 2j40` rIiCD0S0bH80 @ @,D0HdCldO0!P HtA@Hᜏᤏ`A  . % )`+H`, !A7 a, !2 @- @( @ # @, @D @X @l @ሑ @ᜑ @ᴑ0@БL0 @ᨐ` @VqJ QJ  C0mw'ts xKLgo 2:0 @h_`G HX``J hL  l`` c J h@0F{00Q2d J l JI l h RP`fl'ts8hKLgo3*0``#l  \a "\ l`:d l` C%aC d#l P`fl't`s(g@Ao`Kfl`'2C 1aJ`  @p0@t !ApP1 0Q0  ``Lgoqa(0 080 SL `d0 0!0ګ  {dd0lJ T `fl'D0t `KL,217!0A_@I0426p㛫 0J (0` P2@p 0lI ph lHaJ` &(lZ^Ql lH aJ`xh`G )lZ`^, @hh0 +lZ`^G +I*lZ hZ hT llJ Qd O 8C aJ`092B A `S V2:C`l^0'l2G0{Pa 2C 60qa 080 !2V2l@Zh' SK h 001 hL0D daDV2lZ!2lJ SV2l^`D O U L )qZ^kP 2Kd0 Q`6 L hD eD0+UZ*p80Z IP d l l"Dz0AA T2`/ G(0Z^4GR 0;P"20h`D 3{PpQ" 8`Vr ,Q 2` ` dC h ZPlX0a `Q0Q R$8`50617K @l82@Q'N2(*l0Z[$ K0Q7P"M @J@l_0C0S @Q Q @J040` ` `Y0 RQ/)[w'ts xgo902B fl'8xGgᘸ@o0D@0fl'@0؎8`KL *02``#l A@RMл@۶mҹ@ 2`һJD"lDf0dd2 ddҹ*0 bYd z ! d/#l$l /0g 2$2``#l/` $2` b`  0+d$lй`* b 2D  a+`  @p `P` @ሓ#`d#lt0s KL!2go2D (S&B ` b 0J | ^C TK  jP j а`@P cfl't0s2Q J | ^RҮRc2Q J | ^RRc2Q J | ^RCR2Q J | ^R0RRJ t 0J p J` p q`(``Lg o80)0 + ) ` `` 0* 0 2Ad0l  T fl'L0t0 FdL x ,  fl'tc xLg)[)(qZ*[80#<F02OPD02I0L0z)(['t80hH`k0,Lg)[)$qZ*[00D0 0D0)$['tLg)[)(qZ*[1M#40F02NPD02ID0)(['tpKLJg x o 2h`` J x 0 2HD H zdC0 D    0``0D `L0hJh@wJ |  @j @AdF@\J | Q @O @AdFk@8AJ |  @@4 @AdFPLK Ԯ |  AdQJ ԮblTfl't`s0Lg)[)(qZ*[1M#40F02NPD02ID0+)(['ti HC`I0v+hH`2+hH`+Jg t  o(   J` p  `fl'Jg x o fl`'Jg x 0o` fl`'xJg ԮPPPPP&noa J x  A``c0 ~0P`gd,-a`0aF0Aሖdk`J@@0@@p0`m&l'8I P 2J 讂ZQ 2oI H 0L2ZPH cTg cTg `( (   0 8 J  J ` J / J /`pLL 订gcoRUR!P`Ng`  2`]NP+CV8 `QXR0x` J J R2JQ >RJPJ 8R` `fl't02KLA 2K coC0L2[`HTT!HJP 2APDѼ0JJ @ tJ s|Ha2PDS2BlQ ` ¬ʼ` 2ZPH PJ Q ȼ 20J@Zs ᬢѼ 20J @Zg  NO 2J `@ZXVXN ƺ * !҇e$ `  [ T Ƣd T Ɗ w T #~ r |P@AP2Q  `@XVQ2X QHcT ʬ¼ȼts(`KL ,"0Yd` ` cAU! 2J 讂큐ZЬPP2BlЬPAcAT!80dM ƽ - !Յe' `  [ "T ƥ n #T ƍ w T "~ g u |P@AP2Ь cAAT)R{`  A2P:0dO_2ClXAcTjRx`  20JJEZ 2ڼӼPZ@0@d! ۼ 2ZPJP/  NO 2 `@xVZxO ƺ + !҃e% `  [ #T Ƣ n T Ɗ w #T !~ r |AP2ZQJ 讂 `@PVPQ2 QHcT ʬ¼ȼD20 dM `@Q I T cU O T 'd2709ZP2Ԭ acTRy`  a2Td`T T2Bl/0H2`T oJg/2 OA   &d O T >0/ 2CHTH/2cYUnRx` J OdQ88  PƠgO0Р8 0{S0rP 2"tJ PD027PJPO 88 | D0HR P8`CT ` @`RP#2\0{P P`M`ORQ0㗠8 0BJ 28PT0R8P[0J#`x` ``+ 0cgAT2XIVXZ(`Px` C0@dBJ J  J  2cPThRx` 020JJ2PB0BZ2I.Ѽ 2.20JJZePȼ 2ڼӼZ 2ZPJPѼD0f.`flw'ts `Lg o00`@` fl't0 x` `0Yd` ` cUd&P g(0B 20< o$QCgUgL0Ry` 7P8D0Rc`TR02P2JIPJP`IV`0'2c`T Ry`  2JZP`I VBl`B0D0@d `fl't !PƠaO 0 pKLJg 讓@80o0^: 2h3 D 12coPPTZT 0g a ` L2`T2`J2 `!l !a PHBlAlPHAl`Q2HP D0`㽞fl'D0ts0`KL 082`f!G flw0'ts 2cYdo\U` ` cAU 2J ZAH 0L2ZPH5 cT0zPd2)RJI 讃ZPXI(Vs0X!Ѽ h`H2c2cDaAT@ YHPNQ0dQᬢ0g at0 ѼFd*` G22W2x`B2 Cl lP !a@ Bl`Cl@lP@Cl@lH2S2@XHP 0O0㵡2,RJI 讄ZP`I(V` QѼ Q9ᬢ0g!aD0 Ѽ@d*2` G2W2`xB2 Cl lP @` aBlCl@lP@Cl@lH2S2@XHPW O0cS 0 00w2XL2oZQHcTQc2? 0g a 0` G2&2"22O2x@`b2A2 $l lHP!aL2P2@ `!l"lDl@lPH@`@lDlH2T2@`HP 0O0G0- c270x`nR `2I(V`Z20JPBZHJBlHB0 2I0V`ZPJPt0Fd cTQ.flw0'ts 0(  J 2Z0(  @Pg0( o0 2J ZPfl@C'` 2KL`1r 82`hJ dJ R0b@C 0a00 S 0 80G G0)0W0' "2o0d q@h^ l qC000^S[2`8K0D00 2S}QZ*4[D0  ` ` @`lw'ts `KL82)020 0 ڠg3 1 /* ( Pg $c2l` B g  G0HC00` _0HC00 `㓻d$lflw'ts 2P2RR9 20 `  JR2gd@P2d2R2RP: 220 `  JS 2gd@@YP@0⃝pL 2go90f  0    7 g 0PR`™ 'g`fl't0`KL821"0|e0d` * C0=C g dQS0@AQ0)7(MM8R  g dQC0@AQ07(MM8RSS0 rP@G0d UzР0Pа<    0 8 2d@@(P14 2d@(P) `zP<00gg@@J0dPQPR d@#0 8 2d@@8P1# 2d@8P@`zPPP` `flw'ts go `Rl'L 2goD  gfl'D0tafl'tpLgo00-80@`) 2D   D0'f 0AD0>`fl't0xgo80`2A J@ILTS`PаP`P `fl'A080f0K`PC eCf P@C( C P P@C(c CHfxL 2go` 80  0'P cfl't8`K22L1 !Sz0d(C  2P  0d1 0820f@CJ`70 d 2J ^RRc 2g`# 1g `  2g`t 1g` g 2`,` 1g<` ] 2gD`` 1gL` ` 2d[0 0E 2@OP[d0r 808&2@OxQlD0f 0,EP9P|0O0Qdh 0U 0QdZ l2L00D 0 CIC@Cc T` c `01 /`/flw0'ts hKL22"20 lPaR  a!HPIC`) 0eC!xJ2 lJl`SC 0fPCM`( J2e@ P@C( P@C( P@C( C AP CIf0@Q2Q` @ P2 lQ C `V``P J2D a` ` aa Cf/ts(2Aly J 4^RR@@( @X# @h @| @᜘ @ᨘ @ᴘ @ @ИJ   A@gFo 0p@l'CxL!2go` `㪒d  5 (O  `fl't8goJ RN0ydP l'Lg o!28L g:b`Pb`Pb`Pb`PbA`PbA`PbA`PbA`P`  d8 fl't = O8fl'txKLL g o b1`Pl` h`L bN0ydPa 1 d   !`` d  d   ld[ c  b1`P-c O = Oڑ L bA P u !  D0 d2`  N0Pyd l\dL bAP E  bA P 7 X@C!c>  !T2``"l D0 d AO BQV P d lJ XC c c ` J RA P j/l'ts8`KL:2 0)0h  ` 80kI PCV` 0d    3  `Z oH A `ZJ  u  qJ P  bRR] g@C5J1`P D cG' +L b1`P  b  ` CP d hb801`P`  cL b  ` CP d  gK/ Jc ?/ J   L '/N0!02 8R  8P}S0O0000,2q ZPV2lDS0/h/Yagh/T2aq!b2 l/a /ge/haCgR/gfoN0d211P`8 5 (O` ` l'h 2KLI(0C :26%2 !Q2 lJ2oC W*a`Q2 l0g@C` 2J ğ^RR0f@CJ` FCQad_2cHraQ2GcH"h$!l JdcHf@C"S 2J ^RR(a QC 2!{2/ l0/T0jR` lw0'ts(F0e[80ra_2HQ2 l0f@CJ` 7CQa<`/J2o{2s/? l_2 #lC&J/Ju/.Js/Jq/&Jo/Jm/6J` l h{2'lD03v6 2I/F0e0 t/ l#l/B`/ lZ{2T0*R'l,/JR`/&H[2o@ XT2ao@ 2X{2'lZb2/{2[@἟'lC C0 0&H0K0 T2` dX 2[ 0ag !.R`/(a {2.? @3v{2D0'l` 2.{2H'lB/%2`//2X{2\2@0g 'l"K2ZaQ[o.0 g0ag!0g/Z{2L0)R'l.JG`/c2.goV0dl'J ᘹRAOPxLg o!22J2boOOI0b2B fl't`8`KLgh(0``02q0u0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W2 2J,4[o^dC 0H,*4[TZ`!lzh  d!l 0v*\{`VZ3zh 0g03 2A74 `7 @2,4[ADZR 1/ !lZZ0 R & d:0)qZ^R sP0Pg `09)*LqZ,QZ4[mZ`"lgP `%2bB /[^^ ld 0 2>2(`FZ, ^`Z_080X18)C7k'l@ONZ27?ΰ0`10g8 w0rlADo0(0ZZ,`Z02[1Hp dhDqT0 sZ220<0 `g+0@d l l 20&2Q R0Q " 0 Rg 2<0 R"l d:  `@2v50d񼐢0B`b2B 0t00Fd2`P2> l0tB cTV@MyC@OHV2C00P@OP62C0P02'l[2"lQ=02AZx/3.c)[w'ts b00JchCQT@OV P@O!HVC01H@ ` @BPOP22 R5 UZpg `@S0dp T [0X N T 20`5c0@ YgT2M5.1A c/7t`C{/20q ! 1 `0AC@M@OHV l30/+0@<0+/1q R24s7r PADZ0yZIAPIC@OHV l10~/`/1,4[/D^ `Z01P00103@gc0oToo01/01pd1 l!lp01qr 3 `/c/0X1vDc/hgo8010*0 ``b2B `Ufl'B0(20 0`RRKL 2go22 !0g10`!` `B ` ```bB fl't``sRfl'tsK0K0`K0/Z᠘Ob!/xLg o80cl't82­B AA TD V0D00bd2⢊RJb22L0"@Bb22ʭA2J0`a2`ȱ/2goB lc'ѭA Ƞ` `QV0 HJ0bd]l`'hg o(0cfl'(2­B A`@``P2B c/ 22ѭK52&` `g l !` R/ d/B0xR2PB `BKc/20F 2`ʭN`/2`/`KL 290D cflw'ts " ``b2B E` UհB0g8B" `"@ @ %?b2C #"`@ `0b 0PS0زeC0L0{D03`/bK0"@b`xD0c/`Cа/D0/y`2h2B B@ ƀF%q)H x=2x` DGPHPPAPPAPPAPPAPPAPPAPPAPP APP APP APP APP APPAPPAPPgx` lYP J20gP YP2ZƀQ3ƀQ 8ƀQzNb1RƀQ O P8zNRbR OP@ ARyƁV(`(`K2L!2goX *0آ0R# 8; c`(;R `8PB `أ00bس"B 00b000~Pآ3 00$ZOb0>x0=1hy|qBx=YH0p8 1|=SgaHhA J ᴣ^RR|q=YBG0K0cx80-p 5!r 1sgs@EdW`:`TTIﾭ ' Y% %" i@Ihgyx/` p !p qgq@WEd` `CƀB# y````y5.=s dggs9hy`0G0K0x]y:0QT-r|B=ZyG0K0A80V-p x' r'Pr'0G0K0x+~; 0R&3Rgg& K&: :s; ;0.q8PBQqDxxR y 8``y-q|B=YxG0K0c80,yR-x@OP`! $@`8@k-8`?8,Y , ,߭z @`8`x߭c,߭/`?8T-߭x N@d9 )-@:;-`|=XB0G0K0xx80,`|=`XB/1|pBq=cYxG0K0N0 K0+K0IK0xExYq8H0 |=Rg h`y,S5.R/y`,`l2`o@0PP) p }/p yror@Ed) W`2^ 0Q@TP2@0R!0D@Z BSV`HIDI0 P2g !dl-?+xK0@ᄢcIhyq|=YBxG0K080+* /[`8h/@\/A  2IDZ/Ih@yᨢq|=YB-hNgyB,@` |sB2=Z `xG0K0e0/H` @1|pBq=cYxG0K0E0. 0  0 p1g1@Ed* pW`2J (US^TAPT@(`  ᠸR nR2J2D` 4 "dxK00G01x91@0 *Lg *HgQ9`g ``` , Lg/S/L/1|pBq=YxG0K00`./2D/:BB $B0H0Sg /`|=XpBq0xG0K0~00.S/ xQgK00G0xl{9 0U LgE ,2 dg`` d,0G0K0yKz0:P1|pBq=Y/1|pBq=Y{G0K00- Sg0/S/S0/:B0 Sg //S/K0x`xH`0@0`0?~`T"P 2@᰷@N0,#0PCdpPL0@0 n`ރAT@ᨸ@V0 #0PCd^pP` dB0 0+( Bc220:00>K0/ &q𮲣|=YBxG0K0080)@Ihy-@ĢcIhy/0=K0x@cc/@Ģcc/( c38000/K00=[0>K0Vq|B=YG0K0cx780L)p@Ih8=y|XJ+0>K0,@c/  1J` s=YR6:|aBP2x I6 4~;DB2oP4@C2W(2^6HC2^Qa4` 0TO22PZ F@R2oQ40! 0H` 8`~T0R8YBPx`xYp18H0 |=ASg  H`9` *`` ᠍ 0 -3 -0qo0@Ed) qW`2J (^TOP2 D@ES P0` r*S/!Hb"x`TP`` c* 0gTN hD@ASy ) DR4Q/05!HF@RG1H&22I^TOP2 0/22oJ4 d@WCd=/F@R2oR4H/)H@ 냘R~8`T80YBPcxI/0TH2>0CR@62^QG@p` Y4 2@r`Ad W0#PQ0R 4a00;TO22/0Z"HE@R2H 22AJ^TOP2"HE@R0T 4 0 2 d@EWCd0 0"PR4!0022T0J^QTAHP򢸢R 2 22DH2H2 l0 lg 0gH P0R4050N@R.8`T80R~YBP`x. 0 ,0 ,p1g1@Ed* pW`2J (`US^LTP`ఠ`T@ ᠍ 0 ,0 ,p2g2@Ed) pW`2J (^TOP2!HD@ESx`TQ ` )@}R.1H+P(RR 20a/ 0gH PRT/pR)p|B=X~G0K080 ) Rg)H d  I   @H08,@d*<4[09TZ1:@`* H`*p 8`h (@*`FZQZ!@`Bh  dF28`(@[(@᰷@,IZ0 D0"qh(`L0h I @ᨸ@ (LZ0 0``1tCJ` 1H 2g L3  " `1hNgxy1H )H 8` R(H` @ *|p=BX,FIL  /(|=P)80(0 0Rg ((0R/j`P`O`J  ?`l ?o!l`log@ol(@ᐤ"fl`'J 0Q@gg oc 0Jfl'go`xJ @Q`VJ \ `lfl'Jg@C o0$@ J PH J PH J P(HJ Pfl@C'xg80No@Cǁ@CflC'08pLJg80  o10"20$@ 0$@J 0`` `J 0Q @1 ld7 J 0$@fl't`0LLg  o 0$@  0$@J >`;!!1$Afl't@CxLJg P oJ  0$@ 0$@ `L  !@C @֠ !` `J! 1$A AO@CJW ` ᠹZC d `l/!A᜹P2L ` Р%   a! j BQ0d 2 e J PȠ QP 1b0 _CaTQ0d 2 F J ȠHQS- ` B 0 ` ƃ`HC AMBdx`T !M"d`T Md0Hdg`@CJT PJ PJ` ` J  @`l't8pLgo 220 ` !OQV@OV00RJ  `l0$@fl't00J L `goCL   0$@  0$@0` 0$@`v 2 `H `vL0R! @R @XO^c `fl'txgo`jv80! J  `   a!  H 8I^ `Ev8R! @R @XOc `fl'8`KL 224 ` !OQV@OV82 8 80 @ ` 1OZo1A08 p @ h J P @4 @P K Y@0I ZG0P g_7 7PR_P0yR d0R:} )L   0$@  0$@0 0$@ @hX ]H MJ  0$@ 0$@L `0 (H 2dZJ 0$@ ? 2}SQZ  @ဥ@ᘥ` q L7 @Էd/fJ  `l0$@mw0'ts `KL  `0 J Q Ip U1Q 2>02@ @C@qN1ᰥr4s7`J  `l0$@mw0'ts J cT"o`VB0$@J`  `"l0$@xQ`80Cgoh`J  P(H8Cl0$@J  P0Hfl'8J  PIL 2go l` fl'txg80oxP'02$BJ@C BAN"l0$@0$@fl'8gonJc  fl`'J  PHlPB`KL7"0" 00D2 N D0!0w J @HC0V"l`bl0$@`0$@ J  \2'240~2g<0ol H\2'2~2gl N0 ad\2h J `\2'2o92`J cBl`"l0$@o]CH ` J a0$@ `A`QTAV 8@0OJJ AV J B3H @00$@ J xg `ET D J Xo J "a ` BV0$@;H $J 0$@D J o HJ  JB0$@+H#H#J `0$@HD o T0B@)L*`QV0OV0$@ wD  ` ` J BLoB8L0$@8JB0$@D0lw'ts gFo3@C`sl'gfo V0eIC `@C2l'xgFo `'`;@C3w3l'8gFoV0dIC `@C2l'gFoN0d `1``@Cl'pLgo00vNA(d80N LU 'Ab0M0MHR r@J@C AV 5 (O A``l?J'0$@fl't0cT2 2#x X$cT2 2#p P$cT2 2#h H$K4222:4AVOD`T22B  R2o2"lo/`2K4222B $ P ![` VOC4Do`T2B 22 2oZZB  2pJg dQT@OV OAATANVW@0odw@Hi 0` cO"ZxJ` cOy xy &y2fl'00R2  `% !4@2J DIA(ZҬE=QZ` B(E=` `0K@CpKL 2g'4F D"K eao"L @0P2РAPC0wxA(E="a"L @0P2РAP APC0^xA(E=@ဧ J eƪXO @ᘧc/ P T!@@ħ/0N @ RH L  L@/`fl'ts0Lgos `O L eb@$ 0Ϡ +@8vϠH@@mϠH@TdϠ@H@d[ϠPH@lRL e@!bᄨF@L0ᨨe>`fl't`KL10:23`Z )PP 2aT2T0bd'0rZddZl cN И g/C0q0w 7AS@20 B P !T"@ 0Nac@AT92Z2/.P q@1ᴨ00 eQG0 @ب`lw'ts `KL282cA*0`ZXT!7NPƠ 2~A`_ G0"pPR0 EQQ&dcAXT!P`M0flw'ts `K2L 92!4 @2J DXZѠP2a:[T 2d0dd=0ZZl aИ g/N0d cb0F@T7tB΁ T2`U0S 80!!40 @2J DXZѠPO0^00@ 0 @ 0N @J @/`fmw0'ts `KL 2!0 c 0 A0Su J e0Nc@U`f "+4K0I DO @2eASZРJ eEQG0U7N0O `0000` 0`4 "K0I D @2`ZѠPP2T!@  0D0 ` 0NPO0/}PD0 `dQ  `lw0'ts `KLp0!22/ 0cL "/4O0I De @2ASZРJ eEQc@U7NC0]O0000 0` "O0I D @2`ZѠP 0rlw'ts ;lw'ts g@o|fl`'J@ <'@4'gP`PoB0 0` @8dcfl'0@czdThLL go(0D09020v !`D0'f c `fl't(J R"4 @ 2J DZѠP`K(0LT!2!`go  ! !@!#  d b c f l s ha aJ p\2 Kl``AUUVU0RAPORLP25T QiadH`O/]H 5H s SUH H s SMH H t T fl'` D0ts xJg R80o fl'08G@,fl'08xJg R80o fl'08'@dfl'082LgFoB  T V0a` bd2@OVdD ` `l'txL 2go90B     @Aᘩj 2`P ddg@d2⼊ZB @AᴩMh `PaA J bbfl'tB08`KL 2920``c 0 9 2 @OVOAVOVmi@OVOAVOV Y|0Ge0O00 s P@OVOAVOV @0" @Aȩʢ@ 0@Aة0ʠ@OVOAVOHW@OVOAVOW[C }lw0'ts `KL)g[ 2 0*0 lHyaV0!  PI0qr@ S0f2SdlD0K00qr2`h [ &2 ) ZZ` l0$gK0 l) Zf2Z`dl00L0" (0@AM@L0" ) ZC0ya 0000K0 (0@A+@K0$@Aĩ) ['t0s 2`KLgTo!0*0`` 2 @OVOAVOV@OVOAVOV @OVOAVOW20 -,@OV.OAV/OHV9 MP DQ028PHC02J ᐬ^RR` 54@OV67OAVOV@0 0r 2` dZ54@OV6OAV7OV t 10@OV23OAVO5V@O4V6OAV7OVH00R 10@OV23OAVO5V@O4V6OAV7OVH000 10@OV23OAVO5V@O4V6OAV7OVH00 JC@Aةc dD 0l'ts xL 2go WB0>B fl't82xgo 0d0fl'08 fl'8`KJL 21@C I APC01a `am@4`h`u!qNuO0`T2J Ȭ@lZQLuXP 2!@OV!L0B``&ڡ AOQV OV OQV A@@OVBCOAVOW`L0a@OV&! @OV"#OAVOW`L0a @T YMP  dM @OV  @OVOAVOHV``2@\ ! @O8VOAV€HVX` @ᄪb` @O8VOAVO@Vᨪ 0Ǡ@OVOAVOVdcTEQ3 !@OV)@OVXHP"QQ c'd@T  V00!`d28 XGS %d0 @AԪ @1`a _ @OV/=<@OV>?OAVOWD0!DHP102@OVO3VOV`YdMP j/%$@OV&'OAVOWL0Ae`AQ0 (N!d@.mw'ts xKLg)TA[PM3 2D `u )*hqZZ`+h@Z`lPdB ^0'h!D P2813``@2+ZZd102@OVO3VOQVP546@OVO7VOQVPdD (K*h0Z ᬬ[`𰠠0@" J ᬬlSdl`)['ts8`KLE0M0AR"282G L0 ` 04@AX C0!DHP546@OVf27OVlOD0VCn54@OV6OAV7OV2`[ {````y E 2@OVOAVOV1c@OVOAVOV S8%hC "@AȩƢ@ 0Dm@Aةx0nŠ@OVOAVOW @OVOAVOW@OVOAVOW[C hCQ`'| 2 @OVOAVOV0=dD ya` N0G0d000 @Aᘫ G002Ms @Aīu`)[w'ts `KL90A~2pA "2 lHyaV0#4PI05m``46 )4[SD0 000m2`h[ &2 )4ZZ` l0gK0 l)4ZZ`)4[pL0 4 }"F0!4HQ0ya 004 p 0 @A@ 0x"qI1I"22 @OVOAVOV/"@OVOAVOV "qhL: ^0'4!DP 2 @OVOAVOV@OVOAVOVQ`  !D`dD A f2mK0AeD0el2N0`"[ P`"@:i%$@OV&OAV'OV0@OVp @OVOAVOV0 @OVOVOQVp`008 `07A.E08PMHSA.0Ey 8O@R 2 8O2g[  ]8O2 d [J QT AᢑųD0VL0PXMMR82 =0'dAIW0@2|2$0D@8PMHRRGR 90 90?d 5$`T AQ0"(M R!d@ ` AQ08M R!@ 2J ̬^7 dES/$g`T AQ0(M R!d@ ` AQ08M R!@ 2J ̬^EQ a@@ԬAP2` ES d@QXQ PA4PAᢑų dD05L0PXMMRAለpቈG0W0QG0M/MAለSቈG0a@)x_0qZASA004A*xZB0Q`2B `)xqZA0i`2B `V0#ZPpe0)xV2@qZm22˜Q`%@A*D54@OV67OAVOV@Z 0@Aĩ2R21A - `: @A@L0 @Az@V0#4ZPp@Aĩf@A \`) [w'ts `KL)[(*0Z044 Z`)qZJ"2`@ 22`30dBZ@C2(0ZjC^ 0# P09P2 2Q2 0g@  lP d 09PiCP ldJ0 lP(0Z^l )[ts `K2LO"24@O `ZWO01< 0 d` 2 B` l0xL~LO408`XE@I Wj0 4"00xHP 2Z@@N `00P N?JR4 ly'"0 `h/wts g0Fo0`2F2 Pl dPZ2PC@`Cd 0@0l'0d0 0B^L2 2h^o lA!t24xh` J0dSG`@C8` lJXCIC@I@2 dZ0@082C`J0dR@C` lJPCIC@IxKL!282`h G02d  `8c \2QD"Z bZPH0PK0ZRᬓZD^flw'ts8`KL 2* 2Zb0* [D0 0 80c  d/ V@d  GQ" % P 0D0U0`gJGT#` @gcAV d@ PdBQD0O0~ 00' 0 d g0dD00Id@dHP(PC0HR` 2 d d flw'ts KL 2`` `h !b dAZAZ ZP  lh ^RB ^A⬊^ lSA lb ` 2 dPD"HZZR tsL 2go`b "`fl'`"t``KL>( * 0Z+LPZZ(2++Z2,( Z2-+,Z2.(Z2/+$Z22(Z23+$Z0F24`Z(dp25@`Z+0)26`Z(l0*29 Zl+l(01`2:1;aZFZ21017082<1=f2lD0f`D0; ( v`d`Q2@OQ lD0 2p1F8Pp01Pb8P! &rD0)`r 03 CQ)`D0 0!`D0" N080P-^0! P'V0# PL d'd` t F0d`2 21+@ ^P2-^dd lN0" P``j f2^0 lCPD02 1A xhA 222^24^ddK hA82D0`1024RXD2TD02*34Z^42;479d0R4 2Z2 Z2Zdg d l!l 20Qd hAD0`ad D09`[XdQhq0S'2N0" P?R ~0^0 dCP02 A xhA 29^2;^d l4 hQ`0(2790daD3; ZP2g!ld 2[l hA0`2l 09`2Zl[hq0D0N0" Pp3FCPF0dc  d1FwQ04``05``02A`"02!@P"pI`02!P`9`02!`PB`A`24```б fP0;0<``)`09a2;V0# aPPN0" P}D00 `  9. C p) [w'ts gGC C Y C7'i ` ƋR Cg0'ƀQFXƀQ 8ƀQƀ <0x%p> { %s + 0x%x }<0x%p> /* Maybe null pointer? */<0x%p> /* somewhere in u-boot */<0x%p> /* unknown address */Hardware Trace: %4i Target : %s Source : %s SEQUENCER STATUS: SEQSTAT: %08lx IPEND: %04lx SYSCFG: %04lx HWERRCAUSE: 0x%lx EXCAUSE : 0x%lx physical IVG%i asserted : %s RETE: %s RETN: %s RETX: %s RETS: %s PC : %s DCPLB_FAULT_ADDR: %s ICPLB_FAULT_ADDR: %s PROCESSOR STATE: R0 : %08lx R1 : %08lx R2 : %08lx R3 : %08lx R4 : %08lx R5 : %08lx R6 : %08lx R7 : %08lx P0 : %08lx P1 : %08lx P2 : %08lx P3 : %08lx P4 : %08lx P5 : %08lx FP : %08lx SP : %08lx LB0: %08lx LT0: %08lx LC0: %08lx LB1: %08lx LT1: %08lx LC1: %08lx B0 : %08lx L0 : %08lx M0 : %08lx I0 : %08lx B1 : %08lx L1 : %08lx M1 : %08lx I1 : %08lx B2 : %08lx L2 : %08lx M2 : %08lx I2 : %08lx B3 : %08lx L3 : %08lx M3 : %08lx I3 : %08lx A0.w: %08lx A0.x: %08lx A1.w: %08lx A1.x: %08lx USP : %08lx ASTAT: %08lx Ack! Something bad happened to the Blackfin! Please reset the board %cCPLB exception outside of memory map at 0x%p  0### ERROR ### Please RESET the board ### Flash: ethaddr%02X:%02X:%02X:%02X:%02X:%02XipaddrloadaddrbootfileNet: MAC: %02X:%02X:%02X:%02X:%02X:%02X bf548-0.0cm-bf548baudrate %s CPU: ADSP bf548-0.0 (Detected Rev: 0.%d) Clock: VCO: %lu MHz, Core: %lu MHz, System: %lu MHz RAM: U-Boot 1.1.6-svn1214 (ADI-2008R2-pre) (May 5 2008 - 15:33:19)## Booting ldr image at 0x%p ... ## No ldr image at address 0x%p bootldrbootldr - boot ldr image from memory [addr] - boot ldr image stored in memory Address Data Size Valid Locked %2i 0x%p 0x%05X %s %c %c %s CPLB table [%08x]: InstructionDatacplbinfocplbinfo- display current CPLB tables - display current CPLB tables 1K4K1M4Mnone%d%d.%d.%d.%d## Warning: gatewayip needed but not set bad length %d < %d invalid RARP header len bad %d < %d checksum bad ICMP Host Redirect to netretrynoonce ARP Retry count exceeded; starting again gatewayipnetmaskvlannvlanserverip*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: `ethaddr' not set Abort Bytes transferred = %ld (%lx hex) %lxfilesize%lXfileaddr#$@$##$@$<$Load address: 0x%lx Loading: *octettimeoutFile too largeFile has bad magic%02lX%02lX%02lX%02lX.img*** Warning: no boot file name; using '%s' TFTP from server ; our IP address is ; sending through gateway Filename '%s'. Size is 0x%x Bytes = Retry count exceeded; starting again T %lu MB received TFTP error: First block is not block 1 (%ld) Starting again done TFTP error: '%s' (%d) Starting again %&(&H&&*** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d BOOTP broadcast %d DHCP client bound to address autoloadNFSDHCP: INVALID STATE RARP broadcast %d Timeout /nfsroot/%02lX%02lX%02lX%02lX.imgFile transfer via NFS from server Filename '%s/%s'. Load address: 0x%lx Loading: **** ERROR: Cannot mount *** ERROR: Cannot umount *** ERROR: File lookup fail /*** ERROR: Symlink fail 888 9X99,:<<<^==$?j>Error getting the date/time Error setting the date/time ;Zx0N%d erase regions found, only %d used Flash %s timeout at address %lx data %lx Flash %s error at address %lx Command Sequence Error. Block Erase Error. Locking Error Block locked. Vpp Low Error. protectunprotectwritemissing or unknown FLASH type CFI conformant FLASH (%d x %d) Size: %ld MB in %d Sectors Erase timeout %ld ms, write timeout %ld ms, buffer write timeout %ld ms, buffer size %d Sector Start Addresses: (RO) %08lX%sCan't erase unknown flash type - aborted - no sectors to erase - Warning: %d protected sectors will not be erased! erase done unlock## Unknown FLASH on Bank %d - Size = 0x%08lx = %ld MB yesLAN9x18 (0x%08x) detected at 0x%08x Failed to detect LAN9118 (ID_REV = 0x%08x) at 0x%08x SetMacReg: previous command not complete SetMacReg: timeout waiting for response from MAC GetMacReg: previous command not complete GetMacReg: timeout waiting for response from MAC SetPhyReg: MII busy SetPhyReg: timeout waiting for MII command GetPhyReg: MII busy GetPhyReg: timeout waiting for MII command lan9118_write: discarded old TX status ID_REV: 0x%0.8x IRQ_CFG: 0x%0.8x INT_STS: 0x%0.8x INT_EN: 0x%0.8x BYTE_TEST: 0x%0.8x FIFO_INT: 0x%0.8x RX_CFG: 0x%0.8x TX_CFG: 0x%0.8x HW_CFG: 0x%0.8x RX_DP_CTL: 0x%0.8x RX_FIFO_INF: 0x%0.8x TX_FIFO_INF: 0x%0.8x PWR_MGMT: 0x%0.8x GPIO_CFG: 0x%0.8x GPT_CFG: 0x%0.8x GPT_CNT: 0x%0.8x FPGA_REV: 0x%0.8x ENDIAN: 0x%0.8x FREE_RUN 0x%0.8x RX_DROP 0x%0.8x MAC_CSR_CMD 0x%0.8x MAC_CSR_DATA 0x%0.8x AFC_CFG 0x%0.8x MAC_CR 0x%0.8x MAC_ADDRH 0x%0.8x MAC_ADDRL 0x%0.8x MAC_HASHH 0x%0.8x MAC_HASHL 0x%0.8x MAC_MIIACC 0x%0.8x MAC_MIIDATA 0x%0.8x MAC_FLOW 0x%0.8x MAC_VLAN1 0x%0.8x MAC_VLAN2 0x%0.8x MAC_WUFF 0x%0.8x MAC_WUCSR 0x%0.8x PHY_BCR 0x%0.4x PHY_BSR 0x%0.4x PHY_ID1 0x%0.4x PHY_ID2 0x%0.4x PHY_ANAR 0x%0.4x PHY_ANLPAR 0x%0.4x PHY_ANEXPR 0x%0.4x PHY_SILREV 0x%0.4x PHY_MCSR 0x%0.4x PHY_SPMODES 0x%0.4x PHY_CSIR 0x%0.4x PHY_ISR 0x%0.4x PHY_IMR 0x%0.4x PHY_PHYSCSR 0x%0.4x lan9118_write: error status: 0x%0.8x lan9118_read: fast forward op failed lan9118_read: read buffers full! LAN9118: PHY not ready - aborting lan9118_open: can't get TX buffer PHY reset incomplete start Auto negotiation... (take ~2sec) Auto negotiation failed Link down 100BaseTX, full duplexUnknown10BaseT, half duplex100BaseTX, half duplex10BaseT, full duplexAuto negotiation complete, %s Unknown PHY ID : 0x%x, 0x%x read_eeprom_reg: busy at start read_eeprom_reg: timeout ## Command too long! ** Too many args (max. %d) ** Unknown command '%s' - try 'help' Usage: %s 'bootd' recursion detected ## Error: "%s" not defined %.*sbfin> ki:jZjfififi"jverifyBad magic number Bad header crc Bad data crc Bad image type Empty Script ## Executing script at %08lx autoscrautoscr - run script from memory [addr] - run script starting at addr - A valid autoscr header must be present %-12s= 0x%08lX U-Boot = %s CPU = %s Board = %s VCO = %lu MHz CCLK = %lu MHz SCLK = %lu MHz boot_paramsmemstartmemsizeflashstartflashsizeflashoffsetethaddr =%c%02X ip_addr = baudrate = %d bps bdinfobdinfo - print Board Info structure ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gogo - start application at address 'addr' addr [arg ...] - start application at address 'addr' passing 'arg' as arguments resetreset - Perform RESET of the CPU ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Transferring control to RTEMS (at address %08lx) ... %x Warning: src and dst regions overlap ... Error: Bad gzipped data Error: gunzip out of data in header Error: inflateInit2() returned %d Error: inflate() returned %d Image Name: %.*s Created: %4d-%02d-%02d %2d:%02d:%02d UTC Image Type: RTEMSUnknown OSInvalid OSNetBSDLinuxVxWorksQNXU-BootNios-IIUnknown ArchitectureInvalid CPUAlphaARMAVR32Intel x86IA64MIPSMIPS 64 BitPowerPCIBM S390SuperHSPARCSPARC 64 BitM68KMicroblazeBlackfinNiosFlat Device TreeUnknown ImageInvalid ImageStandalone ProgramKernel ImageRAMDisk ImageMulti-File ImageFirmwareScriptbzip2 compresseduncompressedgzip compressed%s %s %s (%s) Data Size: %d Bytes = Load Address: %08x Entry Point: %08x Contents: Image %d: %8ld Bytes = unknown compressionImage at %08lX: Verifying Checksum ... Bad Data CRC OK ## Checking Image at %08lx ... Bad Magic Number Bad Header Checksum bootcmd## Booting image at %08lx ... Bad Magic Number Bad Header Checksum Bad Data CRC Unsupported Architecture 0x%x Standalone ApplicationWrong Image Type for %s command XIP %s ... Uncompressing %s ... GUNZIP ERROR - must RESET board to recover Unimplemented compression type %d autostartCan't boot image type %d bootargsbootmbootm - boot application image from memory [addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image boot - boot default, i.e., run 'bootcmd' bootdbootd - boot default, i.e., run 'bootcmd' iminfoiminfo - print header information for application image addr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums) imlsimls - list all images found in flash - Prints information about all images found at sector boundaries in flash. sssssssssssssssssss"t,t6tJtTt^thtrt|ttttttttt@ttu uu u*u4uttoffONOFFData (writethrough) Cache is %s Instruction Cache is %s icacheicache - enable or disable instruction cache [on, off] - enable or disable instruction cache dcachedcache - enable or disable data cache [on, off] - enable or disable data (writethrough) cache List of available devices: %-8s %08x %c%c%c %s coninfoconinfo - print console devices and information Reset RTC... ## Bad date format unknown Date: %4d-%02d-%02d (%sday) Time: %2d:%02d:%02d SunMonTuesWednesThursFriSaturdatedate - get/set/reset date & time [MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTC read EEPROM @0x%lX %s: addr %08lx off %04lx count %ld ... done eepromeeprom - EEPROM sub-system read addr off cnt eeprom write addr off cnt - read/write `cnt' bytes at EEPROM offset `off' ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ClearLoad%sing %s @ 0x%08lx (%ld bytes) sh_addr: %08X, p_paddr: %08X Loading from: %08X to %08X, size: %d No load address provided tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddrNo bootargs defined ## Not an ELF image, assuming binary ## Using bootline (@ 0x%lx): %s ## Starting vxWorks at 0x%08lx ... ## vxWorks terminated ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx bootelfbootelf - Boot from an ELF image in memory [address] - load address of ELF image. bootvxbootvx - Boot vxWorks from an ELF image [address] - load address of vxWorks ELF image. %sProtected %d sectors Error: start and/or end address not on sector boundary Error: end address not on sector boundary Error: end sector precedes start sector Error: start address not on sector boundary Error: cannot span across banks when they are mapped in reverse order Un-Error: end address (0x%08lx) not in flash! all%sProtect Flash Bank # %ld Bad sector specification %sProtect Flash Sectors %d-%d in Bank # %d bankOnly FLASH Banks # 1 ... # %d supported Bad address format Erased %d sectors Erase Flash Bank # %ld Erase Flash Sectors %d-%d in Bank # %d Bank # %ld: flinfoflinfo - print FLASH memory information - print information for all FLASH memory banks flinfo N - print information for FLASH memory bank # N erase - erase FLASH memory start end - erase FLASH from addr 'start' to addr 'end' erase start +len - erase FLASH from addr 'start' to the end of sect w/addr 'start'+'len'-1 erase N:SF[-SL] - erase sectors SF-SL in FLASH bank # N erase bank N - erase FLASH bank # N erase all - erase all FLASH banks protect - enable or disable FLASH write protection on start end - protect FLASH from addr 'start' to addr 'end' protect on start +len - protect FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 protect on N:SF[-SL] - protect sectors SF-SL in FLASH bank # N protect on bank N - protect FLASH bank # N protect on all - protect all FLASH banks protect off start end - make FLASH from addr 'start' to addr 'end' writable protect off start +len - make FLASH from addr 'start' to end of sect w/addr 'start'+'len'-1 wrtable protect off N:SF[-SL] - make sectors SF-SL writable in FLASH bank # N protect off bank N - make FLASH bank # N writable protect off all - make all FLASH banks writable Unknown operator '%s' Invalid data width specifier -lt<-gt>-eq==-ne!=<>-ge>=-le<=itestitest - return true/false on integer compare [.b, .w, .l, .s] [*]value1 [*]value2 ΎҎڎގ $*.nandnorinvalid partition number %d for device %s%d (%s) incorrect device type in %s incorrect device number in %s out of memory single partnor0staticno such FLASH device: %s%d (valid range 0 ... %d support for NAND devices not present incorrect device: %s%d CRAMFSJFFS2### filesystem type is %s uImage### %s loading '%s' to 0x%lx ### %s load complete: %d bytes loaded to 0x%lx ### %s LOAD ERROR<%x> for %s! fsloadfsload - load binary file from a filesystem image [ off ] [ filename ] - load binary file from flash bank with offset 'off' lsls - list files in a directory (default /) [ directory ] - list files in a directory. fsinfofsinfo - print information about filesystems - print information about filesystems ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Total Size = 0x%08x = %d Bytes %X## R8zﾭeady for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ESC ... loads_echo## Ready for S-Record download ... ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes ## S-Record download aborted loadsloads - load S-Record file over serial line [ off ] - load S-Record file over serial line with offset 'off' loadbloadb - load binary file over serial line (kermit mode) [ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud' loady - load binary file over serial line (ymodem mode) Reading... Mem error @ 0x%08X: found %08lX, expected %08lX Base Address: 0x%08lx CRC32 for %08lx ... %08lx ==> %08lx Pattern %08lX Writing...%12sCan't modify L1 instruction in place. Use cp instead. %08lx: %08x %04x %02x ? Zero length ??? Copy to Flash... Comparison with L1 instruction memory not supported. word at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) halfwordbyteTotal of %ld %s%s were the same %cmdmd - memory display [.b, .w, .l] address [# of objects] - memory display mmmm - memory modify (auto-incrementing) [.b, .w, .l] address - memory modify, auto increment address nmnm - memory modify (constant address) [.b, .w, .l] address - memory modify, read and keep address mwmw - memory write (fill) [.b, .w, .l] address value [count] - write memory cpcp - memory copy [.b, .w, .l] source target count - copy memory cmpcmp - memory compare [.b, .w, .l] addr1 addr2 count - compare memory crc32crc32 - checksum calculation address count [addr] - compute CRC32 checksum [save at addr] basebase - print or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off' looploop - infinite loop on address range [.b, .w, .l] address number_of_objects - loop on a set of addresses mtestmtest - simple RAM test [start [end [pattern]]] - simple RAM read/write test sleepsleep - delay execution for some time N - delay execution for N seconds (N is _decimal_ !!!) ping failed; host %s is not alive host %s is alive hostnamerootpathdnsipdomainAutomatic boot of image at addr 0x%08lX ... bootpbootp - boot image via network using BootP/TFTP protocol [loadAddress] [bootfilename] tftpboottftpboot- boot image via network using TFTP protocol rarpbootrarpboot- boot image via network using RARP/TFTP protocol dhcpdhcp - invoke DHCP client to obtain IP/boot params nfsnfs - boot image via network using NFS protocol [loadAddress] [host ip addr:bootfilename] pingping - send ICMP ECHO_REQUEST to network host pingAddress Saving Environment to %s... ## Error: illegal character '=' in variable name "%s" stdinstdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Error: environment overflow, "%s" deleted setenv ** Abort Environment size: %d/%d bytes printenvprintenv- print environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name' setenv - set environment variables name value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name' saveenvsaveenv - save environment variables to persistent storage runrun - run commands in an environment variable var [...] - run the commands in the environment variable(s) 'var' %K--forceError: 'half' can only be '0' or '1' upperlowerWriting one time programmable memory Make sure your operating voltages and temperature are within spec source address: 0x%p OTP destination: %s page 0x%03X - %s page 0x%03X number to write: %ld halfpages type "YES" (no quotes) to confirm: Aborting OTP memory %s: addr 0x%08lx page 0x%03X count %ld ... W.single bad bit in ECCunknown errorno errorOTP fuse write errorOTP fuse read errorinvalid OTP addressmultiple bad bits detectederror in ECC bitsspace already writtensingle bad bit in half page ERROR at page 0x%03X (%s-halfpage): 0x%03X: %s YES otpotp - One-Time-Programmable sub-system read [count] [half] otp write [--force] [count] [half] - read/write 'count' half-pages starting at page 'page' (offset 'half') stringsstrings - display strings [byte count] - display strings at for at least [byte count] or first double NUL %s ... - No help available. Unknown command '%s' - try 'help' without arguments for list of all known commands versionversion - print monitor version echoecho - echo args to console [args..] - echo args to console; \c suppresses newline helphelp - print online help [command ...] - show help information (for 'command') 'help' prints online help for the monitor commands. Without arguments, it prints a short usage message for all commands. To get detailed help information for specific commands you can type 'help' with one or more command names as arguments. ?? - alias for 'help' In: No input devices available! Out: No output devices available! Err: No error devices available! Cannot initialize the list of devices! serial*** Warning - bad CRC, using default environment Erasing Flash...Writing to Flash... FlashTimeout writing to Flash Flash not Erased Can't write to protected Flash sectors Outside available Flash Start and/or end address not on sector boundary Unknown Vendor of Flash Unknown Type of Flash General Flash Programming Error %s[%d] FIXME: rc=%d flash.c&0:Block sequence errorUnknown errorCan't access fileSorry, zModem not available yetTimed outEnd of fileCancelledInvalid framingCRC/checksum errorCRCCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries f\RH>4*!B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-%2ld.%ld %cB%s0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyz                                                                      F   file errorstream errordata errorinsufficient memorybuffer errorunknown compression methodinvalid window sizeinvalid reserved bitincorrect header checkinvalid block typeinvalid stored block lengthstoo many length or distance symbolsoversubscribed dynamic bit lengths treeincomplete dynamic bit lengths treeinvalid bit length repeatoversubscribed literal/length treeincomplete literal/length treeinvalid distance codeinvalid literal/length codeincorrect data check0.95Pstream endBJ4NJb* F   *rn     ??Board: Bluetechnix CM-BF548 board Support: http://blackfin.uclinux.org/ Warning: unhandled manufacturer continuation byte! Unknown SPI device: 0x%02X 0x%02X 0x%02X Invalid sector! Malloc for sector failed! Read sector failed! Erase sector failed! SPI Program Time out! Write sector failed! SPI Device: %s 0x%02X (%s) 0x%02X 0x%02X Parameters: num sectors = %i, sector size = %i, write size = %i Flash Size: %i mbit (%i mbyte) Status: 0x%02X SpansionSTAtmelWinbondS25FL016S25FL032S25FL064S25FL0128m25p05m25p10m25p20m25p40m25p80m25p16m25p32m25p64m25p128AT45DB011xAT45DB021xAT45DB041xAT45DB081xAT45DB161xAT45DB321xAT45DB642xW25X10W25X20W25X40W25X80W25P80W25P16Starting Kernel at = %x cramfs: wrong magic cramfs: unsupported filesystem features cramfs: root is not a directory cramfs: empty filesystemcramfs: bad root offset %lu size: 0x%x (%u) flags: FSID version 2 sorted dirs holes shifted root offset fsid: crc: 0x%x edition: 0x%x name: %16s %*.*s: unsupported file type (%x) can't find corresponding entry %s %8d %*.*s -> %*.*s [Error reading link] get_node_mem: unknown device type, using raw offset! get_fl_mem: unknown device type, using raw offset! add_node: malloc failed add_node failed! ** ERROR ** %s %08x has dup version =find_inode failed for name=UNKOWN COMPRESSION METHOD = Scanning JFFS2 FS: %c . OOPS Cleanmarker has bad size %d != %d OOPS Padding has bad size %d < %d Unknown node type: %x len %d offset 0x%x  done. %s: Failed to scan JFFSv2 file structure Compression: %s frag count: %d compressed sum: %d uncompressed sum: %d load: Failed to find inode has dup version (resolve) = load: Failed to resolve inode structure load: Failed to read inode %.3s %.3s %.2d %.2d:%.2d:%.2d %d %s %8ld %s %s -> ls: Failed to scan jffs2 file structure NONEZERORTIMERUBINMIPSCOPYDYNRUBINZLIBxwrd-`--..->.LT\dpx|/-\mnJanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat     noo ooo op{t{x{|{{{{{{{{{{@  ((0088@@HHPPXX``hhppxxȯȯЯЯدد  ((0088@@HHPPXX``hhppxxȰȰааذذ  ((0088@@HHPPXX``hhppxxȱȱббرر  ((0088@@HHPPXX``hhppxxȲȲввزز bootargs=root=/dev/mtdblock0 rw earlyprintk=serial,uart1,115200 console=tty0 console=ttyBF0,115200bootcmd=run rambootbaudrate=115200loads_echo=1ipaddr=192.168.0.15serverip=192.168.0.2autoload=norootpath="/romfs"gatewayip=192.168.0.1netmask=255.255.255.0hostname=cm-bf548loadaddr=0x1000000ubootfile=u-boot.ldrupdate=tftp $(loadaddr) $(ubootfile);protect off 0x20000000 0x2003FFFF;erase 0x20000000 0x2003FFFF;cp.b $(loadaddr) 0x20000000 $(filesize)addip=set bootargs $(bootargs) ip=$(ipaddr):$(serverip):$(gatewayip):$(netmask):$(hostname):eth0:offramargs=set bootargs root=/dev/mtdblock0 rw earlyprintk=serial,uart1,115200 console=tty0 console=ttyBF0,115200ramboot=tftp $(loadaddr) uImage;run ramargs;run addip;bootmnfsargs=set bootargs root=/dev/nfs rw nfsroot=$(serverip):$(rootpath),tcp,nfsvers=3nfsboot=tftp $(loadaddr) vmImage;run nfsargs;run addip;bootmflashboot=bootm 0x20100000 (((((AAAAAABBBBBBT\tXdtt #+3;CScs !1Aa  0@` Hܹ,T 0,XкP`TĻh t@@        Ȧ @Ц ئ @ $,4 (<  40 <0@D0L0T \   0000000003fa0000 _start0000000003fa00bc _get_pc0000000003fa00c8 _exception_init0000000003fa00e0 _cpu_init_f0000000003fa0164 _irq_init0000000003fa01ec _get_tbclk0000000003fa01f8 _enable_interrupts0000000003fa0218 _disable_interrupts0000000003fa0228 _udelay0000000003fa0260 _timer_init0000000003fa02a0 _get_timer0000000003fa0300 _get_ticks0000000003fa0314 _reset_timer0000000003fa0324 _trap0000000003fa03d4 _evt_default0000000003fa0484 _decode_address0000000003fa0534 _dump_bfin_trace_buffer0000000003fa05dc _dump0000000003fa08a4 _bfin_panic0000000003fa08e0 _trap_c0000000003fa0a34 _bfin_reset_trampoline0000000003fa0a54 _do_reset0000000003fa0a5c _bfin_reset_or_hang0000000003fa0a64 _memset0000000003fa0ac4 _get_vco0000000003fa0af0 _get_cclk0000000003fa0b4c _get_sclk0000000003fa0b88 _sbrk0000000003fa0bbc _icplb_add.27290000000003fa0bd0 _dcplb_add.27330000000003fa0be4 _init_cplbtables0000000003fa0d28 _hang0000000003fa0d3c _board_init_r0000000003fa0f18 _board_init_f0000000003fa1088 _strcpy0000000003fa109c _strncpy0000000003fa10bc _strcmp0000000003fa10d8 _strncmp0000000003fa1100 _dma_memcpy0000000003fa11a4 _memcpy0000000003fa11fc _icache_disable0000000003fa1218 _icache_status0000000003fa122c _dcache_status0000000003fa1240 _icache_enable0000000003fa125c _dcache_disable0000000003fa1278 _dcache_enable0000000003fa1294 _flush_cache0000000003fa12e4 _do_bootldr0000000003fa1360 _show_cplb_table0000000003fa13d4 _do_cplbinfo0000000003fa143c _memcpy_ASM0000000003fa14b4 ___fswab160000000003fa14c0 ___fswab320000000003fa14e4 _startAgainTimeout0000000003fa14f4 _startAgainHandler0000000003fa1500 _NetSetHandler0000000003fa1510 _NetCksum0000000003fa1534 _NetCksumOk0000000003fa1550 _copy_filename0000000003fa1580 _string_to_VLAN0000000003fa15bc _getenv_VLAN0000000003fa15d0 _string_to_ip0000000003fa1624 _getenv_IPaddr0000000003fa1634 _NetEthHdrSize0000000003fa166c _VLAN_to_string0000000003fa16bc _ip_to_string0000000003fa16f8 _print_IPaddr0000000003fa1718 _NetSetEther0000000003fa17b8 _NetCopyIP0000000003fa17c0 _NetSetIP0000000003fa1874 _NetWriteIP0000000003fa188c _NetReadIP0000000003fa18a4 _PingHandler0000000003fa18d0 _NetSendPacket0000000003fa18d4 _ArpRequest0000000003fa19d8 _NetReceive0000000003fa1dd8 _PingSend0000000003fa1f08 _NetSetTimeout0000000003fa1f40 _NetSendUDPPacket0000000003fa2058 _PingTimeout0000000003fa2074 _NetStartAgain0000000003fa20e8 _ArpTimeoutCheck0000000003fa215c _NetLoop0000000003fa255c ___fswab160000000003fa2568 _TftpSend0000000003fa26a8 _TftpStart0000000003fa288c _TftpTimeout0000000003fa28dc _TftpHandler0000000003fa2b28 ___fswab160000000003fa2b34 ___fswab320000000003fa2b58 _truncate_sz0000000003fa2b84 _NetCopyLong0000000003fa2b8c _NetCopyIP0000000003fa2b94 _DhcpOptionsProcess0000000003fa2d38 _NetWriteIP0000000003fa2d50 _NetReadLong0000000003fa2d68 _DhcpExtended0000000003fa2ed8 _BootpRequest0000000003fa3064 _DhcpRequest0000000003fa3068 _BootpCopyNetParams0000000003fa3104 _DhcpHandler0000000003fa33bc _BootpTimeout0000000003fa33fc _RarpRequest0000000003fa34dc _RarpHandler0000000003fa3530 _RarpTimeout0000000003fa3570 _eth_initialize0000000003fa3580 ___fswab320000000003fa35a4 _NfsTimeout0000000003fa35c8 _basename0000000003fa35f8 _dirname0000000003fa3618 _rpc_lookup_reply0000000003fa3694 _rpc_add_credentials0000000003fa3740 _rpc_req0000000003fa3828 _rpc_lookup_req0000000003fa3870 _NfsSend0000000003fa3a6c _NfsStart0000000003fa3c90 _NfsHandler0000000003fa40b0 _rtc_reset0000000003fa40bc _wait_for_complete0000000003fa40e4 _rtc_init0000000003fa40f4 _rtc_get0000000003fa415c _rtc_set0000000003fa4254 _GregorianDay0000000003fa434c _to_tm0000000003fa4454 _mktime0000000003fa44e0 _flash_make_addr0000000003fa44f4 _flash_read_uchar0000000003fa4508 _flash_read_ushort0000000003fa4528 _flash_read_long0000000003fa4568 _flash_add_byte0000000003fa45d4 _flash_make_cmd0000000003fa4610 _flash_write_cmd0000000003fa468c _flash_unlock_seq0000000003fa46d8 _flash_isequal0000000003fa475c _flash_isset0000000003fa47f0 _flash_get_size0000000003fa4b14 _flash_full_status_check0000000003fa4d1c _flash_real_protect0000000003fa4dd8 _flash_write_cfiword0000000003fa4f24 _write_buff0000000003fa505c _flash_print_info0000000003fa5158 _flash_erase0000000003fa52a8 _flash_init0000000003fa53b8 _flash_read_user_serial0000000003fa540c _flash_read_factory_serial0000000003fa5460 _lan9118_udelay0000000003fa5488 _MacBusy0000000003fa54a8 _smsc9118_initialize0000000003fa5504 _SetMacReg0000000003fa5574 _GetMacReg0000000003fa55e4 _PhyBusy0000000003fa560c _SetPhyReg0000000003fa568c _GetPhyReg0000000003fa5704 _eth_send0000000003fa5c30 _eth_rx0000000003fa5e44 _eth_halt0000000003fa5e58 _eth_init0000000003fa62b8 _read_eeprom_reg0000000003fa6324 _board_get_enetaddr0000000003fa63e8 _run_command0000000003fa66ec _do_run0000000003fa6750 _cread_add_char0000000003fa6800 _cread_add_str0000000003fa6848 _readline0000000003fa6d9c _main_loop0000000003fa6e0c ___fswab320000000003fa6e30 _autoscript0000000003fa6f8c _do_autoscript0000000003fa6fc4 _print_num0000000003fa6fd8 _do_bdinfo0000000003fa713c _do_go0000000003fa71c4 ___fswab320000000003fa71e8 _gunzip0000000003fa731c _zfree0000000003fa7324 _zalloc0000000003fa7330 _print_image_hdr0000000003fa7624 _do_imls0000000003fa770c _image_info0000000003fa77d4 _do_iminfo0000000003fa782c _do_bootd0000000003fa7850 _do_bootm0000000003fa7cf0 _on_off0000000003fa7d2c _do_dcache0000000003fa7d94 _do_icache0000000003fa7dfc _do_coninfo0000000003fa7eb4 _cnvrt20000000003fa7ef0 _mk_date0000000003fa8044 _do_date0000000003fa8118 _eeprom_init0000000003fa8130 _eeprom_write0000000003fa8180 _eeprom_read0000000003fa81d0 _do_eeprom0000000003fa82c4 _valid_elf_image0000000003fa8304 _load_elf_image0000000003fa8428 _do_bootvx0000000003fa8564 _do_bootelf0000000003fa8620 _flash_fill_sect_ranges0000000003fa8724 _flash_sect_protect0000000003fa87ec _addr_spec0000000003fa88cc _abbrev_spec0000000003fa89a4 _do_protect0000000003fa8c04 _flash_sect_erase0000000003fa8c74 _do_flerase0000000003fa8da0 _do_flinfo0000000003fa8dec _evalstr0000000003fa8e08 _evalexp0000000003fa8e50 _binary_test0000000003fa8f68 _do_itest0000000003fa8fdc _jffs2_part_info0000000003fa9040 _id_parse0000000003fa90f0 _mtdparts_init0000000003fa9230 _do_jffs2_fsinfo0000000003fa92a0 _do_jffs2_ls0000000003fa9300 _do_jffs2_fsload0000000003fa941c _ktrans0000000003fa9448 _chk10000000003fa9468 _bin_data_init0000000003fa9494 _bin_data_char0000000003fa94c4 _k_data_init0000000003fa94dc _k_data_save0000000003fa9530 _k_data_restore0000000003fa9584 _k_data_char0000000003fa95e0 _send_pad0000000003fa9610 _s1_sendpacket0000000003fa9634 _handle_send_packet0000000003fa97e8 _send_nack0000000003fa9844 _send_ack0000000003fa98a0 _getcxmodem0000000003fa98bc _do_load_serial_bin0000000003fa9e64 _do_load_serial0000000003faa0b4 _do_mem_base0000000003faa0f0 _do_mem_crc0000000003faa174 _do_mem_mtest0000000003faa24c _cmd_get_data_size0000000003faa2b0 _mod_mem0000000003faa424 _do_mem_nm0000000003faa440 _do_mem_mm0000000003faa45c _do_mem_loop0000000003faa508 _do_mem_cp0000000003faa64c _do_mem_cmp0000000003faa7e4 _do_mem_mw0000000003faa888 _do_mem_md0000000003faaa84 _do_sleep0000000003faaaf0 _do_ping0000000003faab5c _netboot_common0000000003faad94 _do_nfs0000000003faad9c _do_dhcp0000000003faada4 _do_rarpb0000000003faadac _do_tftpb0000000003faadb4 _do_bootp0000000003faadbc _envmatch0000000003faae14 _getenv_r0000000003faaeac _do_saveenv0000000003faaed8 _getenv0000000003faaf40 __do_setenv0000000003fab2a0 _do_setenv0000000003fab2d0 _setenv0000000003fab2f8 _do_printenv0000000003fab444 _do_otp0000000003fab750 _do_strings0000000003fab810 _do_echo0000000003fab878 _do_version0000000003fab898 _var_complete0000000003fab8f0 _find_cmd0000000003fab95c _cmd_auto_complete0000000003fabcfc _install_auto_complete_handler0000000003fabd18 _install_auto_complete0000000003fabd58 _do_help0000000003fabe8c _console_setfile0000000003fabef8 _fgetc0000000003fabf14 _ftstc0000000003fabf30 _fputc0000000003fabf4c _fputs0000000003fabf68 _disable_ctrlc0000000003fabf78 _had_ctrlc0000000003fabf88 _clear_ctrlc0000000003fabf98 _dbg0000000003fabfa4 _console_init_f0000000003fabfb0 _console_assign0000000003fac024 _fprintf0000000003fac06c _puts0000000003fac080 _vprintf0000000003fac0b4 _printf0000000003fac0f8 _console_init_r0000000003fac250 _serial_printf0000000003fac294 _putc0000000003fac2a8 _tstc0000000003fac2b8 _getc0000000003fac2c8 _c